SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009152 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009152
Domain Number 1 Region: 1287-1451
Classification Level Classification E-value
Superfamily PH domain-like 1.85e-66
Family Pleckstrin-homology domain (PH domain) 0.00000484
Further Details:      
 
Domain Number 2 Region: 1082-1289
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.19e-46
Family DBL homology domain (DH-domain) 0.000000169
Further Details:      
 
Domain Number 3 Region: 482-598
Classification Level Classification E-value
Superfamily PH domain-like 5.91e-20
Family Pleckstrin-homology domain (PH domain) 0.0035
Further Details:      
 
Domain Number 4 Region: 872-941
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000679
Family Interleukin 16 0.056
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000009152
Domain Number - Region: 791-833
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0909
Family Ras-binding domain, RBD 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009152   Gene: ENSGACG00000006898   Transcript: ENSGACT00000009172
Sequence length 1699
Comment pep:known_by_projection group:BROADS1:groupXV:3571328:3609196:-1 gene:ENSGACG00000006898 transcript:ENSGACT00000009172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNSESQYSIQGPKGTSFVFPGRPKPCSLKLQSARDDALSPHTWWKTAPLGSGYKARCVA
RGCLSPPKSRPPYSPRHGDYVSKGIRGSPGEHRWRRSPGCGLRRRHTSDQYEDNPYGADI
TGGTLNAHTDEHKALEEQSSPRVVIKKDGSLRVEFTNTSGNPVLLDEASGPVQLLKFSPN
LESASTPSLPGSSGSRQDGHHGGPPPASTSSTARTSKGSSLSSDGSWYDSPWGPGTELCE
QEQPCSASRTLVHSPMHPLEQTPPVSITDLYKDSTMAATFPTARDLSSHLHQPAQGQRPH
RASFASVLDVPLEEESAEACQYSSYTLPCRRPKAHTMSEDKKDSIKNRMRRFSDWTGSLS
RKKRKSQECRYKDLGDAFDSGVDGLTADTSSPSQVSSLLWFPGASRAQSSGAIHQTTSDA
LRQNIYENFMRELETDAGKGGGGGGERRDPSTGTEEGESSNESAEGSLEQLDLLFEKEQG
VVRRAGWLSFKPLVTLHKDKKLELVTRRKWKQYWVTLKGCTLLFYQTYGKGSLEQEMSPR
YALLAEDGIVQAVPEHPKKENVFCLSNSYGDVYLFQASNQTDMENWVTAIHSASASLLAK
RQGKEDTVRLLRSQVRSLLQKIDMDGKMKKMAELQLTVVSDPKNRKAIENQIQQWEQNLE
KLTXLPNPKSLLATASRPKLTLGRLGIFSVSSFHALICSRDEATLRRRSLSLTHRRRKKG
LFSSLKGLDNLTKRGRDKRPSASQIFESDAGAFSLDTLPQSSSANPSNIYSMSPPEGSLW
DGISGASDALTCVYMPDGLTVQVPVRRDQTAADLLSASCKVKQLDAGLHCLRLHRRAGQG
VEVRYLAPGELLGDVVNDQLEVVPVNVFNLHMRRPSDAGDFGFAVTGHIDSQKNSRIFVS
EVLPDDLAFNEGLRPGDEILVLNGRCVSGLDLALIQTLFAEQDLHLSLRRVDPASPLNSA
LTWWSLIEMFSYSQKKRCLVIVLPPPGLTELFEDFFSNPQKSTVQRWRAVSGVTTVMQRL
ISTGCHHPCARSPEFTPPLQSAETVCTLYQSFQEGAGSGSGGLMDDTKEPPARPCPGHMS
ATERLRKVIQELVDTEKVLRQGAKDLACLFEIYLKPLQSETFLTLDEMESLFGSLPEMLD
FQRVFLQTLEERIASSPDFSTLETPSQFKRLLFSLGGSFLYYADHFKLYSGFCANHIKVQ
KVLERAKTDQAFKEFLDARNPTKQHSSTLESYLIKPVQRVLKYPLLLRELVSLTDAESEE
HYHLTQAQKAMEKVASHINEMQKIYEDYGSVFDQLVAEQSGQDKEVAEISMGEFLMHSSV
VWLNPHSSLGRMRKHPEMTVFVFKKAVILVYRENNKLKKKMSSCDKQSAPRGDSDPFKFR
WLIPLSSLQVRLGNTAGTGTESSCIWELIHCRSEVEGRPETVFQLCSSVLENKVSVIKVV
RSILRENVRRNMRGEETVEKNSKEQQLVPNRGHFPSAVKLGTTRAFWLCRQPLGDLAAQA
GHPKPGPDSDEGSLSSGTCSLSGAAPPPPLHASSGSHLLPVQQKPQTRRSPPAVKESDIL
SDEDDDGFSEGGARRGSGDSGSPTSGVEAQLLRLRLSEDAAQAPRVQPERLGDTPETQPR
LVRGHFSAVKRKSGSLRRSQGALLHMRQHSRSLDSQTDAASSPGVPDLNALLEREFSVQS
LTSVVNEDCFYETEEAPNA
Download sequence
Identical sequences G3NUY3
69293.ENSGACP00000009152 ENSGACP00000009152 ENSGACP00000009152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]