SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009155 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009155
Domain Number 1 Region: 190-249
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000475
Family Ras-binding domain, RBD 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009155   Gene: ENSGACG00000006893   Transcript: ENSGACT00000009175
Sequence length 324
Comment pep:known_by_projection group:BROADS1:groupVI:8061981:8076601:-1 gene:ENSGACG00000006893 transcript:ENSGACT00000009175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDRMGERPTYVKLSEEKLIPKSAILSLLRTYNCYHEGKNFQLRAREEDEALILEGLLNIY
WGLRRPIRLQMYDDNERFRLNRQISLAQRLSFYRNDRSGLEKQLSPESNNNSPGTDGGPS
SGDVCGREEEDSPQLLRTRSDASFMRVQRRSRTHTARDLQRLRTHRFSINGHFYNHKTSV
FTPAYGSVTNVRVNSSMTTGQVLNLLLQKFRVENKCEEFVLYMVHESGERTRLKDGEYPL
VARVLCGPCEKISKILITEADVGEEVTYDVAQYIKFEIPVLDSFVEKLKEEEEREINKLT
KKYSALKNMIQHRLEGGAHTSERI
Download sequence
Identical sequences G3NUY6
69293.ENSGACP00000009155 ENSGACP00000009155 ENSGACP00000009155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]