SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009181 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009181
Domain Number 1 Region: 31-171
Classification Level Classification E-value
Superfamily PH domain-like 9.04e-31
Family Pleckstrin-homology domain (PH domain) 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009181   Gene: ENSGACG00000006926   Transcript: ENSGACT00000009201
Sequence length 301
Comment pep:novel group:BROADS1:groupXV:3665047:3669462:-1 gene:ENSGACG00000006926 transcript:ENSGACT00000009201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTEVWSDFERRLRCSLQSFRSWWQAAFPISVPPSMSGDDYNPVSLRNKSKRKTRGGDGT
MSRRRISVKELGAPDHQGWLYRKKESKGFLGIKWKKYWFVLKKTALYWYTNQLAEKAEGY
IDLTNFMIDRAIECKKKHAFKACHPHVLMFYFAAETHEDMNLWLNKLGLASIKYQPIDQN
AAVECYSEASDHEEAESTEIPPPPYCEQTLRDSVDASGPPGSSHQDTLPPPYSSAVPSEA
NGSFSSPVSTMTSQSSTSSLAKQRQSWLDLVSQAAPPSAEAAAAVCSVQVHLHTPPRSGA
G
Download sequence
Identical sequences G3NV12
ENSGACP00000009181 ENSGACP00000009181 69293.ENSGACP00000009181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]