SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009186 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009186
Domain Number 1 Region: 180-289
Classification Level Classification E-value
Superfamily PH domain-like 2.66e-35
Family Pleckstrin-homology domain (PH domain) 0.0072
Further Details:      
 
Domain Number 2 Region: 96-195
Classification Level Classification E-value
Superfamily PDZ domain-like 3.42e-25
Family PDZ domain 0.00023
Further Details:      
 
Domain Number 3 Region: 312-424
Classification Level Classification E-value
Superfamily PH domain-like 0.0000155
Family Pleckstrin-homology domain (PH domain) 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009186   Gene: ENSGACG00000006912   Transcript: ENSGACT00000009206
Sequence length 532
Comment pep:known_by_projection group:BROADS1:groupXX:7736265:7758383:1 gene:ENSGACG00000006912 transcript:ENSGACT00000009206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APKMAVVITTGVPGVSGVQKSGFLDVLVRERWHKVLVNLNEEALTLSCEEEDCGPDRDSV
TPNGVTNGSYLDNNNANSNNGPHAARTAFTDLPERVPEAIANRKRCVKVTKQEIGGLGVS
IKGGKENKMPILISKIFKGLAADQTQALYVGDAILSVNGVNLRDATHDEAVQALKRAGKE
VTLEVKYMREATPYVKKGSPVSEIGWETPPPESPRLGSPTVLSSPTSFSFSGDRRCIPLK
MCCVTRALTTPDPENRQLELHSPDARHTVVLRCPDQPSALSWFSAMHSVTSKLAKRALSE
VIHSTARTDVAGSREIRHLGWLAGKVGTESEKQCWKPVLVVVTEKDLLLYESLPRGKEAW
QSPAHQYPLLATRLVHSGSERGSPHSGTELLFATRTGTRLGIETHLFRAETAKDLSLWTR
QLVNGCHASAEMIKEVTTSCLYQSQECRLVIHYEQGFSVLADPKLGDGPQVLLSYPYEKL
KMSSDDGVRMLFLDFGGEEGEIQLDLHSCPKPIVFILHSFLSAKIYRLGLVA
Download sequence
Identical sequences G3NV17
ENSGACP00000009186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]