SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009197 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009197
Domain Number 1 Region: 177-302
Classification Level Classification E-value
Superfamily PH domain-like 2.91e-34
Family Pleckstrin-homology domain (PH domain) 0.0066
Further Details:      
 
Domain Number 2 Region: 93-192
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-25
Family PDZ domain 0.00023
Further Details:      
 
Domain Number 3 Region: 325-435
Classification Level Classification E-value
Superfamily PH domain-like 0.00000391
Family Pleckstrin-homology domain (PH domain) 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009197   Gene: ENSGACG00000006912   Transcript: ENSGACT00000009217
Sequence length 556
Comment pep:known_by_projection group:BROADS1:groupXX:7736274:7757648:1 gene:ENSGACG00000006912 transcript:ENSGACT00000009217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVVITTGVPGVSGVQKSGFLDVLVRERWHKVLVNLNEEALTLSCEEEDCGPDRDSVTPN
GVTNGSYLDNNNANSNNGPHAARTAFTDLPERVPEAIANRKRCVKVTKQEIGGLGVSIKG
GKENKMPILISKIFKGLAADQTQALYVGDAILSVNGVNLRDATHDEAVQALKRAGKEVTL
EVKYMREATPYVKKGSPVSEIGWETPPPESPRLGSPTVLSSPTSFSFSPSDSPSSPSMPS
LSLQGDRRCIPLKMCCVTRALTTPDPENRQLELHSPDARHTVVLRCPDQPSALSWFSAMH
SVTSKLAKRALSEVIHSTARTDVAGSREIRHLGWLAGKTESEKQCWKPVLVVVTEKDLLL
YESLPRGKEAWQSPAHQYPLLATRLVHSGSERGSPHSGTELLFATRTGTRLGIETHLFRA
ETAKDLSLWTRQLVNGCHASAEMIKEVTTSCLYQSQECRLVIHYEQGFSVLADPKLGDGE
NREERGAHTPTRPQVLLSYPYEKLKMSSDDGVRMLFLDFGGEEGEIQLDLHSCPKPIVFI
LHSFLSAKIYRLGLVA
Download sequence
Identical sequences G3NV28
ENSGACP00000009197 69293.ENSGACP00000009197 ENSGACP00000009197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]