SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009232 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009232
Domain Number 1 Region: 207-349
Classification Level Classification E-value
Superfamily PH domain-like 2.21e-38
Family Third domain of FERM 0.0000119
Further Details:      
 
Domain Number 2 Region: 104-208
Classification Level Classification E-value
Superfamily Second domain of FERM 1.83e-29
Family Second domain of FERM 0.00000703
Further Details:      
 
Domain Number 3 Region: 20-103
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.96e-24
Family First domain of FERM 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009232   Gene: ENSGACG00000006968   Transcript: ENSGACT00000009252
Sequence length 984
Comment pep:known_by_projection group:BROADS1:groupXII:8898809:8916649:1 gene:ENSGACG00000006968 transcript:ENSGACT00000009252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSEKTPSKASKSPQKSSKRPKTVPVKVTLLDGSDYEAGVEKFAKGQTLLDMVCGHLNLLE
RDYFGLTFQDTDTAKHWLDPSKEIKKQILGSWIFGFSVKFYPPDPSVLIEDITRCTTCGL
QLRDDILGRLPCSFVTHALLGSYTVQAELGDYEAEDHGPDYVSDFRFAPNQTHELEERVM
ELHRNYRGMSPAEAEVNFLENAKKLSMYGVDLHHAKDSEGIDIMLGVSANGLLIYRDRLR
INRFAWPKILKISYKRSNFYIKIRPGEYEQFESTIGFKLPNHRASKRLWKVCIEHHTFFR
LVSPEPPPKGFLVIGSKFRYSGRTQAQTRQASALIDRPAPQFDRSVSKRYMLPRSIDGAS
ALGYSMEQLSHRSSSERTQFMSREDLDQEGSLDLDHDQYHYQDQDQEQDQDQYPELDLEQ
HDGQNQDQVQRQTWGSHISTTTKTLELKVQGYTQNPASNTSSLPSALLLFLSCRVYAVVV
KHKKHFSRLFVTGGNSIVFVVITMIPTDYYPSVVNYDRNIKRELADAESALLPFCRVNGF
PVKHANACLNLNCNLFSFNCLAARLFDSPAALYLFVSARICPPPSPSLPEPPFPTSCFAQ
TPFTPSRLPHLGFGHKDMATHRPKQEMCPSLCKQQFLDKPDDVLQKHQASINELKRALRQ
PNSKMAQREKRLSSATPPGGTPEREPEVPKIVPLKPQRSKKYLNNENSGVGSDQSRSDGG
VFGAAGDAQMTEPRDESCEDTPPTPAIHEEPFNEASLKETHLGIERKCSSITVSSTSSLE
AEVDFTVLTDLHSGMEEFSRGMTELGERDASPDAEGVRPEVKRPDPVVPKKPKRSVPVSS
SVDREAGRVSAVTPLSREASDVAPTPAARKTDVRTETQPNGSEVTTTIVEFTDQVHIGRE
ASRSPILITENVTSATTHVSKTVKGGYSETRIEKRIIITGDDDVDQEQALAIAIQEAKQQ
HPDMQVTKAVVVRETESSAEDRHS
Download sequence
Identical sequences G3NV63
69293.ENSGACP00000009232 ENSGACP00000009232 ENSGACP00000009232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]