SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009249 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009249
Domain Number 1 Region: 408-523
Classification Level Classification E-value
Superfamily PH domain-like 3.82e-33
Family Pleckstrin-homology domain (PH domain) 0.0000273
Further Details:      
 
Domain Number 2 Region: 121-195
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.93e-21
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0007
Further Details:      
 
Domain Number 3 Region: 250-312
Classification Level Classification E-value
Superfamily Cysteine-rich domain 5.53e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009249   Gene: ENSGACG00000006980   Transcript: ENSGACT00000009269
Sequence length 603
Comment pep:known_by_projection group:BROADS1:groupXV:3714812:3741271:1 gene:ENSGACG00000006980 transcript:ENSGACT00000009269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAYSPPSLPRAILHSLHPHQPPSSSGPLYARLSNGGHSVPSPTNSFHGVSFLLQIGLTR
ETVNLETGDLSLSAVKDLVCSIVDQKFPECGFFGMYDKILLFRHDLNDDNILQRLTSAED
IHEGDLIEVVLSAQATVEDFQIRPHALYVHSYKAPTFCDYCGEMLWGLVRQGLKCEGCGL
NYHKRCAFKIPNNCTGVRKRRLSNVSLPGACLSVPRPSPAENAVVVQDEQRPHQEAGKRI
LSWSGRPIWMEKMVLGRVKVPHTFAIHTYTRPTICQYCKRLLKGLFRQGMQCKDCRFNCH
KRCASKVPRDCLGEVDFNGEPASPGPDSDTTMDNMEVDSGDMDGGRGLDDPEEPSTPDER
MFDMDSPLLDREKDEEPIKTISPSTSSNIPLMRVVQSIKHTKRRSSTVVKEGWMVHYTSR
DNLRKRHYWRLDSKSLSLFQNDTGAKFYKEIPLSEILQVEQSGDYSNLAQGSNPHCFEII
TATMVYYVGENNRSHYHSPALAASGVGMDVAQGWEKAIRQALMPVTPQPSVASAAGQGKD
HKELSISISVSNCQIQENVDIASVYQIFSDEVLGSGQFGIVYAGKKLPKYDIYDISKLPN
WKI
Download sequence
Identical sequences G3NV80
ENSGACP00000009249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]