SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009258 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009258
Domain Number 1 Region: 323-633
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 2.62e-112
Family Mammalian PLC 0.000000366
Further Details:      
 
Domain Number 2 Region: 653-778
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.16e-33
Family PLC-like (P variant) 0.00026
Further Details:      
 
Domain Number 3 Region: 184-322
Classification Level Classification E-value
Superfamily EF-hand 1.24e-28
Family EF-hand modules in multidomain proteins 0.01
Further Details:      
 
Domain Number 4 Region: 30-142
Classification Level Classification E-value
Superfamily PH domain-like 2.55e-25
Family Pleckstrin-homology domain (PH domain) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009258   Gene: ENSGACG00000006988   Transcript: ENSGACT00000009278
Sequence length 999
Comment pep:novel group:BROADS1:groupX:9663874:9673697:-1 gene:ENSGACG00000006988 transcript:ENSGACT00000009278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDGSRAGRVRKKTVSFSSSLSEKKISSAADCIHSMVEGIELKKVRTNSRVYQRYYLLDAG
LQALCWEPSKKESDKARISLASIREVRTGRNTETFRTSGVYEQISEDCAFSIIYGEMYES
LDLVANSAEVANIWVTGLRYLMQYGKHALDMLASSQDSLRLGWLEQMFLSAADSDGQEDV
EEGIRLQLAVKLVQSVNPGVGARKVEHRFKELQRVREKINERVTRQQFIEVFHDFCTRPE
IYFLLVQFSSNKEFLDTKDLMRFLEAEQGMTQVSEEASLKLIQSQEPSEEGQQEGYLSLD
GFTSYLTSAECHLFDKEHHGVCQDMSQPLSHYYISSSHNTYLIEDQVRGPSDISGYIRAL
KMGCRCVEVDVWDGPDGEPVVCTGYSLSPPLALRCVLEAIGKFAFVASQYPLIICLENHC
SLQQQKVMCQHLVRILGEKLYNGPPCEGESYLPSPHALRHRILLKGKTLGPGPDGDEGEV
SEEDEGAEMGQRLKAAAAPSDPLHVLPKRFQLLKELSDLVTLCRSVRFIDFPTSSKSQNP
CELCSFHESLAVRLAGERPGDFVNHNKHFLSRVYPSPARMDSSNMNPQDLWKCGCQIVSM
NFQTAGLMMDLNTAWFRQNGNCGYVLRPAIMRQEVSYFSADTRDTVPGVSPQLLHVKVIS
GQNLPKPRGSGTKGDVVDPYVYVEIHGIPADCTERRTRTVTHNGDNPVFDESFEFQINLP
ELVMVRFVVLDDDFIGDEFIGQYTIPLECLQPGYRHVPLQSLTGEELPHAKLFVHVALTN
RRGGGKPHKRGLSVRKARKGRDYTALRDSGVRAVDEVFKMAAPPLREATDLRENMQNSVA
VFKELCGVSAVANLMQCVLALGSRVSGPDGAPLLLFNLHDHYPALEPQGPLPDVLRRVVS
NYEMMVQASRAVMELSDGIHDRILQIQTRAPAMEFHEKLPSLAAKEGLRGRKVSRALESF
SWNITILKGQADLLKHAKAEVQENTKQVHDAALTGNLTK
Download sequence
Identical sequences G3NV89
69293.ENSGACP00000009258 ENSGACP00000009258 ENSGACP00000009258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]