SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009283 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009283
Domain Number 1 Region: 2546-2829
Classification Level Classification E-value
Superfamily BEACH domain 9.68e-113
Family BEACH domain 0.0000000511
Further Details:      
 
Domain Number 2 Region: 2888-3094
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.42e-24
Family WD40-repeat 0.00084
Further Details:      
 
Domain Number 3 Region: 2379-2507
Classification Level Classification E-value
Superfamily PH domain-like 1.78e-16
Family PreBEACH PH-like domain 0.011
Further Details:      
 
Domain Number 4 Region: 990-1178
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000292
Family Pentraxin (pentaxin) 0.083
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000009283
Domain Number - Region: 451-554,749-836
Classification Level Classification E-value
Superfamily ARM repeat 0.0288
Family Armadillo repeat 0.086
Further Details:      
 
Domain Number - Region: 1311-1398,1524-1557,1660-1733
Classification Level Classification E-value
Superfamily ARM repeat 0.0357
Family Plakophilin 1 helical region 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009283   Gene: ENSGACG00000006972   Transcript: ENSGACT00000009303
Sequence length 3108
Comment pep:known_by_projection group:BROADS1:groupVI:8176997:8208938:-1 gene:ENSGACG00000006972 transcript:ENSGACT00000009303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SEEARREVVRFFQRQDAEETNCGATDSRGWLLLKALLLLTADNSVSESCKLKLRLPAALV
KCLYLLVCLPAEKENSATEETFQEQLTQSELLLPALLQVLLQLCRKPGNVERLVETQELQ
CLIIGLTSLWDQTSATWRHQASRVLKAVSAAATSNTVPSLQGKNCVRICIQNLLHIRADV
SGSLLAEVAVAVFSFIRDTYSLNPALFVEFDNNNGYKALELILKRCEEGVSVDTLQPVEE
LLALIASFTLLGKTELKVALCVTNPQPPAFRFDPPLTKGLTVKNLAAVHLLQSSLLRSHD
AALCCQLLRTFRTIWEEDPANFFLLEWTIQSTSQLAACVWRKPAPVQKLFFSMLEMVIFK
LNYIPHETLRALLLVLKQNWSGTLAGGVAGDPSPLVCRMTVHSGMIAEVLSDWGLLELLL
SEIRRRAKILRKAGVVSSPQINPQQLSSVEDSERLLTACMLQVVSALTLRSIKNTISVRD
LGMVPYIKIFLDEDQFRGPTLRILEQLAEINPEEFMSTAIGALCSSTQQELGLKRDLLQS
MRKVLESPNSWDAFRRAGGFTGMLSLVIDMEGALSEHPQVEVWKSVGHQPLLDLLLLTLH
ILALAVHLHTVNAHHFEAGGFYERLAEALLQLGCFHAGVPEEEICEEDAVSGPKTAEPNL
PVALRTCIRLLSYLDKFATGTYSSLELNLGLDPENGCDKEKANGPAGHEGVFSGSPPVHT
GPGLPSVEDTQSAQIPSTAYRRFSCNHIILHPGAIRVIMTLLPSVFTPKDPQLSMEVQFS
LVHHVQAMVESERNRQIVCEGGLVSTLLAHCRRMLLAPNHPLHLPVTRILEKLASHAITL
SDFRKFLCLGDPLMCWAERSPPVKPPSLNGNDSISSFFSEPDHGTEAEVSSGSSFKKLKR
TFSLLKSTTRSESPFGPAVPVHQIISLVSMTSPRTYRPHRVSSSPAFVEFDMAESGYGCL
FLPSLATVKGVAADSIPTGGIGGECRGFPPSAGLSFSCWFQINRFSSACDSHPIRLLSVV
RHMSRTEQQYICLSISFSAIDGCLVISTEEEAFTYLDMMEPEVCSPTPLTTSLRFQCSSM
LVPGQWHHLAVVLSKDVKKSCIASAYFNGKAVGTGKMKYIQPFPGQYVSMDPAAVVDVFG
LMGTPALWKEHAALVWRVGPSFLFEEALSPEAVIVVYTQGTAYQGNFLAVGHAGLDPAAE
CAVLRLVPEERISFGINPAISLITTVVQIRENYNEVDCRLIAKEMGITSRDHSTPVFLAQ
NVSQHLGGTARTIGAALVGHFGVRKFTPRSASNGFLYVGGPAVVLSLIAMAPDDGSLYAA
VKVLLSVLETNSAMRKEMNRINGYKLLAFLLKMKHNLVSYRTFQLVLYLSRWVELSSGPD
CTQNTPAFQALLCDPEVWRNTSDNLDLLALNHFAEIQKSSSSDSRNAKVMHSTGMLPNLL
FELCDPAVTVQKVKIISSVITSLLKAHLTPLDTSRLGLFLVYTLPPLSNVNEGSNEIFDS
DLSQDAPGTPCGTQRSEPASLIWIRNQLLRSLCEILDSDGLQIKDSLQKALIDSLGSDWF
LLFLQPHLHHSTLKLGLVLLTHFLSSPSQQSSFREGVLPATLIEGMEEPLVLETNLNINI
LGCCLDTSDNLQANSRSFESLSTTCPGFDVLRGLLIRHTHLPQVFEAIASLLLEKKTSHT
TEEIIFIFPFRNSLMWNLQVQLDGFLQSLIDGQKANPAQQLCVEAATILLSLVKAIITQP
GPPKKNPSGTDTSWELQLPASVMQFLCLLHNQRPRDPLWASPEFLHALAGVLYPLDVSEP
KQFSVAGLIDSFFSPPHPCIMSEGDDTFKNPPNRKPVCDFIRILLMDILFNVSANTHTHP
LLLLLEFSPEGASLEQRQSFQTELLELTMDIIHMLSHEEENNTHLIAQGSKRQTPEGQMC
TLMENVVFFSKTLQQKLYSGTFLGNSESLINFLADQIGVALEKGQAQKENVVSALYSSTN
KVLLYLLSQPRRSQEEKDVVIRALRTFIERWDVVMATYNANVNFITCLLHCLLLIRSGSY
PKGFGSVPQKALNRKASSQLSAARSRHPARLSNGADVTTDDTELVSLAEACWSKVMAERQ
HMLEETSKMEISASHMAETGPVSMTDVSPLWEEMAHKAWLLYTDSQKQNVAGSSLKTPGR
ESVTVEVNSHFGSLAQDGYSKPRSKSAVPKHHPKREEEFLSYMESRRQRGHSMFENMRTN
HTQLRASEWEQVSSKWLRVEAELLRERAVFGPGPGVLLNQDWVQEAAEGPNRTRSRIRRK
ALRRSKRFFVNQSVDVGSLGERVHVFESEPKILCEVGAEAKEDEPEGGQDFDRLTFFPVL
NETAAVAGGPPGSLTPEPCSHTQDCHNTRIILQELQPGEEVKAKTSVVTVSGLRVTEGVL
LFGKDSLLLCEGFALSPAGDFQSFRSFIPVCHSVPASVRDSFISTMLSTELPPARCRRWL
YEDIKDARFIRFLLEDNAIEVFMKNGLSAFLVFLNKDHVAAYKRLCMVVPALKGRGAAEV
EVGQSHQVADGLGHRLQKTAVVEKAALVKWQRGDISNFEYLMHLNTIAGRTYNDLMQYPV
FPWVLADYQSETLDLSDPLTFRDLSKPMGAQTEKRRRMFIERYEEIESIEDEGNLSAQCH
YCTHYSSAIIVCSFLVRMEPFSHTFQALQGGFDIAERMFYSVKKEWESASRDNTGDVREL
IPEFFYLPDFLLNSNHIQLGSMGDGTALGDVELPPWAKGDPQEFIRNHREALESDYVSAN
LHLWIDLIFGYRQQGPAAIESVNTFHPYFYAKKGRRDASDPLIKSTILGYVSNFGQVPKQ
LFTKPHPPRSGSKKEGSSTAHPTPFFFKLDNLKTTVQPFRELPRGPVGQILCLEKEVVVL
EGFRLFLSPLSGCFFSWGFPDYSCSFGNYGTEKTFAVCESLCDWGATLCAACPNQRTVVT
AGTSTVVCVWDVAVNKDRLTHMKLRQPLYGHTDSVTCLAVSEVHGVIVSGSRDLTCILWD
MEELSYITQLAGHTTSVSALAINELTTKGEIASCAGPLLYLWTMKGQLLTRTDTSCGPRA
DVLCVRFTQRHEWDAKNVVVTGCADGVIRIWKTEYTRTQLPGPPEEPV
Download sequence
Identical sequences G3NVB4
ENSGACP00000009283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]