SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009293 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009293
Domain Number 1 Region: 431-720
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-78
Family Protein kinases, catalytic subunit 0.000000000331
Further Details:      
 
Domain Number 2 Region: 929-1067
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 4.97e-58
Family FAT domain of focal adhesion kinase 0.000000241
Further Details:      
 
Domain Number 3 Region: 149-269
Classification Level Classification E-value
Superfamily Second domain of FERM 6.13e-40
Family Second domain of FERM 0.00000159
Further Details:      
 
Domain Number 4 Region: 47-146
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.01e-38
Family First domain of FERM 0.0000124
Further Details:      
 
Domain Number 5 Region: 270-378
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-34
Family Third domain of FERM 0.00000348
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009293   Gene: ENSGACG00000007004   Transcript: ENSGACT00000009313
Sequence length 1073
Comment pep:known_by_projection group:BROADS1:groupXX:7834636:7865105:1 gene:ENSGACG00000007004 transcript:ENSGACT00000009313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSSFLEPNLNHSTAGGCGVKSRAGIPVGTAVGTSGSAAGLERPSGSMDRVLKIFHYFE
TNSEPCTWASNIRHGDATDVRGVIQKIAEIHKLRCVSSLGLRLTHLHSDALHWLHPDLGV
CHVREKYEKQHPQEEWRYELRMRYLPKGYLSHFSEDKPSLNYLYHQVKSDYMQHIADQVD
QEIALKLGCLEIRRFFREMPGNALDKKSNYELLEKDVGLRRFFPKSLLDSLKAKTLRKQI
QQTFKQFANLNDEQSIHKFFEILSPIYRFDKECFKCALGSSWIISVELAIGPEEGISYLT
DKGSMPTHLANFNQVQTIQYSALEEKDRKGMLQLNVAGAPEPLTVTTALLTTAENMADLI
DGYCRLVSSATHSFIVRVHKEGDRALPSIPKVSNHERRMEKRMEGVRTRAVCVSETDDYA
EIIDEEDTYTMPSTRDYEIQRECIELGRCIGEGQFGDVHQGVYISPENPALSVAVKTCKN
STADSVREKFLQEALTMRQFDHPHIVKLMGVIPDNPVWIIMELCTLGELRSFLQVRKYSL
DLASLILYSYQLSTALAYLESKRFVHRDIAARNVLVSTVDCVKLGDFGLSRYMEDSSYYK
ASKGKLPIKWMAPESINFRRFTTASDVWMFGVCMWEILMFGIKPFQGVKNNDVIGRIENG
ERLAMPPQCPPTLYSLMTKCWSYDPSKRPRFTELKTQLSTILEEEKQQQKERSRMEMRRQ
VTVSWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHPGHYQDQMAGYPGPHTLPSVPSA
LYPPQATMLDTHHAHTHPRHHVHSHAQHLPHPHGHDMALWGSAMEQCLVMEEQLMIQQQQ
MEEDQRWLEQEERLLKPDSRSSRGSLDREDGGLQPPTGNQHIYQPVGKPEHAAPPKKPPR
PGAQGQVGSLTCLNSGDSYNEGVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMS
SKIQPAPPEEYVPMVKDVGLALRTLLATVDETLPQLPASTHREIEMAQKLLNSDLAELIG
KMKLAQQYVMTSLQQDYKKQMLTAAHALAVDAKNLLDVIDQSRLKMMSQSRPH
Download sequence
Identical sequences G3NVC4
69293.ENSGACP00000009293 ENSGACP00000009293 ENSGACP00000009293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]