SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009304 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009304
Domain Number 1 Region: 374-736
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 3.01e-127
Family Hect, E3 ligase catalytic domain 0.00000000369
Further Details:      
 
Domain Number 2 Region: 3-126
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.8e-21
Family PLC-like (P variant) 0.039
Further Details:      
 
Domain Number 3 Region: 284-324
Classification Level Classification E-value
Superfamily WW domain 0.000000000000428
Family WW domain 0.00072
Further Details:      
 
Domain Number 4 Region: 142-181
Classification Level Classification E-value
Superfamily WW domain 0.0000000000148
Family WW domain 0.001
Further Details:      
 
Domain Number 5 Region: 238-279
Classification Level Classification E-value
Superfamily WW domain 0.000000000364
Family WW domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009304   Gene: ENSGACG00000007003   Transcript: ENSGACT00000009324
Sequence length 743
Comment pep:known_by_projection group:BROADS1:groupXI:3717812:3739910:1 gene:ENSGACG00000007003 transcript:ENSGACT00000009324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSLSFSVLCAKNLVKKDFFRLPDPFAKVVVDGSGQCHSTDTVRNTLDPKWNQHYDLYIGK
SDSITISVWNHKKIHKKQGAGFLGCVRLLSNAINRLKDTGYQRLDLNKLSPNDSDTVRGQ
IVVSLQSRDRIGSGGPVVDCSRLFDNDLPDGWEERRTASGRIQYLNHITRTTQWERPTRP
ASEYSSPGRPLSCIVDENTPVSTNGATPTAVPPPINGEQRVPERRVRSQRHRNYMSRTHL
HTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSNVNCEELGPLPPGWEIRN
TATGRVYFVDHNNRTTQFTDPRLSANLHLVLNRQNQVKDQAQQALVSPGHLPEEAECLTV
PKYKRDLVQKLKILRQELSQQQPQAGHCRIEVSREEIFEESYRQVMKMRPKDLWKRLMVK
FRGEEGLDYGGVAREWLYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAVNPEHLSYFHF
VGRIMGMAVFHGHYIDGGFTLPFYKQLLGKPITLDDMESVDPDLHNSLVWILDNDITGVL
DHTFCVEHNAYGEIIQHELKPNGKSIPVSQDTKKEYVRLYVNWRFLRGIEAQFLALQKGF
NEVIPQHLLKAFDEKELELIVCGLGKIDIHDWKSNTRLKHCTAESNIVKWFWKAVESFDE
ERRARLLQFVTGSSRVPLQGFKALQGAAGPRLFTIHQIDASPNNLPKAHTCFNRIDIPPY
EHYDKLYDKLLTAIEETCGFAVE
Download sequence
Identical sequences G3NVD5
69293.ENSGACP00000009304 ENSGACP00000009304 ENSGACP00000009304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]