SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009322 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009322
Domain Number 1 Region: 33-234
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.24e-55
Family BCR-homology GTPase activation domain (BH-domain) 0.00012
Further Details:      
 
Domain Number 2 Region: 4-41
Classification Level Classification E-value
Superfamily PH domain-like 0.00000712
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000009322
Domain Number - Region: 527-597
Classification Level Classification E-value
Superfamily Tropomyosin 0.00203
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009322   Gene: ENSGACG00000007032   Transcript: ENSGACT00000009341
Sequence length 613
Comment pep:known_by_projection group:BROADS1:groupVI:8231272:8233960:1 gene:ENSGACG00000007032 transcript:ENSGACT00000009341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGLSHESFLLMANSQSDMEDWVRAIRRVIWAPLGGGVFGQHLEETMLYEAQCGPQRLVPV
LVEQCVCFIREHGLQEEGLFRAPGQANHVRELQDAFDRGEKPVFDSTTDVHTVASLLKLY
IRELPEPIIPFSKYTQFLSCAQLLTKDKAMGKVELGKQVKSLPQVNNNLLTYICKFLDEV
QSHSSENKMSVQNLATVFGPNILRPRVEDPVAMMEGSTQVQHLMTVLISEHTKLYQREEV
KTETKIPPKQLSPIQRCKVEWLSVEDSLASKSPKEEPQLSTPSKDSKPTVPSPITRSEKG
EDGLIEERGQGMTEEKVDGQADSKTEARGGSEAPVSPSKQSKASPTWRSSFKGGAASGGQ
RGKVGGSAGDVSAAGGSNWLINGLSSLRAHKRTTSSGERLRDATMKDSTLSLKETTVPTK
DTQRHSDEDSSPTPLYHRALLQSHRLSAYENVAPSSLSLPADTSSPWTSFEIPLAEPEGS
DSAVKLGQGQERPTEVRDSTGPLDNGAKSPEKGTNEGLTSLLTELKRELKEQRTSNETCI
RKLEESLSEYQSQVNRLEEELDQEKKKFHMLEIRFRNSERAHQDAENRNILLQKEMEEFF
KTLGDLTTGATRT
Download sequence
Identical sequences G3NVF3
ENSGACP00000009322 69293.ENSGACP00000009322 ENSGACP00000009322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]