SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009407 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009407
Domain Number 1 Region: 484-769
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 3.95e-39
Family C5 cytosine-specific DNA methylase, DCM 0.0047
Further Details:      
 
Domain Number 2 Region: 145-283
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.68e-32
Family PWWP domain 0.0000271
Further Details:      
 
Domain Number 3 Region: 386-453
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000468
Family PHD domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009407   Gene: ENSGACG00000007097   Transcript: ENSGACT00000009427
Sequence length 771
Comment pep:known_by_projection group:BROADS1:groupXVIII:5882534:5900659:-1 gene:ENSGACG00000007097 transcript:ENSGACT00000009427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPEEPEPSPSPRKKRGRQKLVQTEKNKDEPDDRNYDSPKEGETGRLRRRPVPRVTFQAGD
PYYISRRQKEEWLSRWKMEAERRAYREAEMNMMDDLSEGDFQKEEESASPAPPPSQQQTA
PASPTVAVTPEPVAGVERATPREIEYQDGRGFGIGVLVFGKLRGFSWWPGRIVSWLMSGR
SRAADGTRWVMWFGDGKFSVVCVEKLMLLSSFSPAFHQPTYNKQPMYRKAIFEALQVASV
RAGRPIPSCDASDDADGVEIQTRQIIEWAMNGFPPKGPQSLEPPEEERNPYKEVYPEMWV
EPEAAYTPPPAKKPRKNSAEKAKIREVIDEGTRERLICEVKKKTRNIDDICISCGSLNVS
LEHPLFGGAMCQGCKNSFLECAYQYDDDGYQSYCTICCGGREVLMCGNNNCCRCFCVECV
DLLVGPGSAATAIKEDPWNCFMCGPRSSFGLLRRRDDWPSRLQHFFANNHEQDFEPAKLY
PPVSAEKRKPIRVLSLFDGIATAGLLVLKDLGMQVDKYVASEVCEDSITVGMVRHEGRIM
YVGDVRNVTRKLKIEEWGPFDLVIGGSPCNDLSIVNPARKGLFEGTGRLFFEFYRLLHEA
RPKTGDARPFYWLFENVVAMGVSDKRDISRFLECNPVMIDAKEVSAAHRARYFWGNLPGM
SRPLTAMMNDRLDLQDCLEHGRTAKFEKLRTITTRSNSVKQGKDEHFPVFMDNKEDILWC
TEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRHLFAPLKEYFACN
Download sequence
Identical sequences G3NVN8
69293.ENSGACP00000009407 ENSGACP00000009407 ENSGACP00000009407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]