SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009428 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009428
Domain Number 1 Region: 417-525
Classification Level Classification E-value
Superfamily Second domain of FERM 2.09e-28
Family Second domain of FERM 0.00027
Further Details:      
 
Domain Number 2 Region: 526-635
Classification Level Classification E-value
Superfamily PH domain-like 1.51e-25
Family Third domain of FERM 0.0058
Further Details:      
 
Domain Number 3 Region: 741-844
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-24
Family PDZ domain 0.01
Further Details:      
 
Domain Number 4 Region: 927-1028
Classification Level Classification E-value
Superfamily PDZ domain-like 6.18e-24
Family PDZ domain 0.00052
Further Details:      
 
Domain Number 5 Region: 1058-1165
Classification Level Classification E-value
Superfamily PDZ domain-like 7.1e-20
Family PDZ domain 0.045
Further Details:      
 
Domain Number 6 Region: 329-417
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.79e-19
Family First domain of FERM 0.011
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000009428
Domain Number - Region: 17-159
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000102
Family Protein kinases, catalytic subunit 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009428   Gene: ENSGACG00000007110   Transcript: ENSGACT00000009448
Sequence length 1172
Comment pep:known_by_projection group:BROADS1:groupVI:8247197:8256856:1 gene:ENSGACG00000007110 transcript:ENSGACT00000009448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKPIRKWEGRMSSTFVTLAEVLEARGGPLLEEEVWSLLLGTAESLVDVSYMGQNNMCYII
SPTSLLLSATGTLAFKNCGLSDDVSTFTAPEMLQGRASSTKPAIERMLVYSLGMTLYWSV
DFQLPQNQPVQLSDHLNSLLLCMCEDLAHRRVTLNAILEACDCQHKATVLPSPTKVIKQL
VEEVFHESTSVKAAVKGEDSLQTLTQSQVLKRIQNGRKNFSCVLSTHLWESTSETLETKA
TELSHTDVPILVGPTAPWGSSQGQQLQLAWASGRSHSPSISFSESSLSLSNRKAKALGPE
FVRMSDEQQIVLELPGSIVSRKGRSCSSQREVTVVLPSGQYVVVRCDIKSKARDVFDMVV
AHANLVEHFYFGLAFIDDDEYFFLDNETKISKIAPDSWKKGQIASFLVFLRVKFFVDDMS
FVLHRLTRHQYYLQLRRDLLEDRIHCNEETGLFLAALALQAEFGDYMQEVQRKNYYQPEH
YVSKRMLEKLALPNVKEELPRLHASHAQILPEEAETEYLKIAQQLPEYGVMFHRVGREKR
LAAGEMVLGICAKGIIVYEMKNHLRSVIRRFLWRETDTISTGRRKLVIECGGPSGKKHSF
ITESSKIAQYLLNLCSAQHKFHSEMTSRQLNHTMISDESMDKYMSAYRDRNLSLKRISCS
EGMLNHVGLTPGQPDSLSKSCENLTDKLEARLRQQREMRREISRELNKELTETGELRDVK
ERQCWRMMSSVSLHKQDSDASSSIRVDTPTRTPPEREIVCVNLKKDPKLGFGFVIVGEDN
TGKLDLGIFIASIVPDGPADKDGRIKPGGRLISLNKTSLEGVTFSDAAAILQSSPEVVEL
IVSQPRLFPSESLKDRARSLSQSTLGLALERSFGSQTTLSGTEYRPVVEELEEAISLSSL
ATTPKHSRRLHIPVVRIHDAQDKCSRSPSILSLKSGERFAMELRKSSGSLGISVAGGINT
NVRYGGIYIKSLVLGGAAEQDRRIQIGDRLLEVDGFNLRAVTHNQAVECLKRTGEVVNLL
LEREPTVILESRPDSPCPLLTQSSSHTQPPMSEVSMETTLSGRAKDYSFVTDDNTLEVVL
KKSLSGLGFSFNISHLHSGPDRGSVVRIKRLFPGQPAIESGLLREGDVILSVNKEPVRDL
SYQRVLFLLRGAPSEVNLRICRPGPGVLYDID
Download sequence
Identical sequences G3NVQ9
ENSGACP00000009428 69293.ENSGACP00000009428 ENSGACP00000009428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]