SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009430 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009430
Domain Number 1 Region: 680-786
Classification Level Classification E-value
Superfamily PH domain-like 2.1e-19
Family Pleckstrin-homology domain (PH domain) 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009430   Gene: ENSGACG00000007117   Transcript: ENSGACT00000009450
Sequence length 800
Comment pep:known_by_projection group:BROADS1:groupI:4716822:4758126:-1 gene:ENSGACG00000007117 transcript:ENSGACT00000009450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHQLFGQVLGQRDLSRAGDLFSLEDKEIEACLSQALDQIKAISCSQDYLTNDNDQAVVEI
CITRITTAIRETGSIERHSTALVGLWESCLEHNLTPQGESTEDTPHTKIASDITSCILQN
YSCPSVMVLAVPVAVRFLQSGNRELSRNMSSYLSLAAIAKADLLAEHTKAITLSVLGGNH
MLLRVLPSVYPRQPDTIHCQLGNLTAMMSQLESPEQQHLIRLIQIVAEQHPLMLSPQVPA
LVGYLGDQSLTEALLGSLVDVSQASPSSLVSFLPTLRIVGQQCPALLGKVAKIHGAVGII
SETHALSVLVYLVSCLGSMEHSFHHTLLLEIRALTDRYPSLLGGCGKDIYRMSNSFTAIA
RLLGQRLEESTATHRSRGNEACLPTPGASLPGGGLGSEQRLQVKIQALEEDSPAPQRRYS
LSQAVREERREMRFNRSKSLALHAGRSRSVNSDAGEDGEGSEPSPDGNVSNASALSQHEE
APPAERKPQGDGSMPVTAAKEAEEGQNEDTDRLFIYLRDNIETVRAFCRDTAQQIPVPEQ
CAIEDSNRGCVAKLSFSCPLKGHYCLYAKSCFNLTSRQPQLWIRIMLLHLQSKSSVALCS
KDECVQRLASLWEKTQLKGAHSFPVAMTENTTPHRKDLNSLQIQLEEVRFFDLFGYSEEE
EGWLCFMCNLPDQSIVVVNQEGQPLIEGKLKEKQVRWKFIKRWKTRYFTLAGNQLLFRKG
KSKDELDDIPIELSKVQSVKVVAKKRRDRGLPRAFEIFTDSKTYVLKAQDEKHAEEWLQC
IHVAVAQARERENREATTYL
Download sequence
Identical sequences G3NVR1
69293.ENSGACP00000009430 ENSGACP00000009430 ENSGACP00000009430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]