SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009479 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009479
Domain Number 1 Region: 890-1168
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.02e-68
Family Protein kinases, catalytic subunit 0.000011
Further Details:      
 
Domain Number 2 Region: 583-876
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.02e-41
Family Protein kinases, catalytic subunit 0.00019
Further Details:      
 
Domain Number 3 Region: 438-563
Classification Level Classification E-value
Superfamily SH2 domain 6.5e-16
Family SH2 domain 0.006
Further Details:      
 
Domain Number 4 Region: 150-280
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000513
Family Second domain of FERM 0.0093
Further Details:      
 
Domain Number 5 Region: 374-442
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000393
Family Third domain of FERM 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009479   Gene: ENSGACG00000007145   Transcript: ENSGACT00000009499
Sequence length 1178
Comment pep:known_by_projection group:BROADS1:groupVIII:7971478:7992100:-1 gene:ENSGACG00000007145 transcript:ENSGACT00000009499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTPWVMELSRQLCGKMRKSSKRAQLSSSPTSIRGLEIHFYTPDVRQLLYLKGCYTALNL
CVDAAKKCSISPLCHNLFALYDEATGMWYPPNYEINITDETSFKLHYRMRIRFYFRNWHG
TTEGESPVWRHCLSKLRGGLSPQKTPEGTPLLDAASLDYLFAQGQHDFQTGLVPLRASSS
EAEQHEIENECLGMAVLAITHYTTNMDMTLTTAANESSYKRFIPESLNRNIKQRNFLTRI
RINNVFKKFLSEFNRRTIKDSKITPYDLKIKYLATLEGLTSGLGSELFEPVSLVLTQEGD
LCNGSYGYGYSNQGQEEIQKPNMKTSHDMHVLVTGTNGISWRKKPATSTGISKEKGKLKK
VKLDGKQKNGKSMEANEDWVVFCDFHEITHTVIKETMVTVYRQDNKRMELHMASRGEALS
FAALVDGYFRLTVDAHHFLCKEVAPSSVVFNINNGCHGPICTEYATHKLRQEGHEEGTYI
LRWSCTDYEYIIITVVCNEIDLNESRPVRQYKNFQIEVASNGFRLYGTETFRATLTELLE
HLKGQSLRTDNLQFRLLHCCPPQPREVSNLLVVTKDRAPATQTPMQESQLSFHRILKEEI
EQEEHLGPGTRTNIFSGTLRVKSEEEEDAGYSSFQEVKVVLKVLGSGHRDISLAFFETAS
MMRQVSHKHIVLLYGVCVRHQENIMVEEFVQPGPLDLFMKRQQSPLDTLWKFQVAKQLAS
ALSYLEDKKLVHGFVCAKNILARDGLDADMGGPFIKLSDPGIPITVLTREECVRRIPWIA
PECVKSASSLSVAADKWGFGTTLWEICYDGEVPLKDKKLTEQKEMFYVSECQLATPECKE
LAELMTHCMTYDPKKRPFFRAIVRDIDMLEEKNPSIKPQPTPDVDPTLFEKRFLKKIREL
GEGHFGKVELCRYDPRGDKTGELVAVKSLKSENREEQSNNLSREIDILKALYHENIVKYK
GICQEEGCQANKLIMEYLPLGSLKDYLPRNKNKTSLKTLLSYSVQICEGMDYLGSRNYIH
RDLAARNVLVESERTVKIGDFGLTKSIKDNEGYYTVKDENESPVFWYAPECLTHCKFYLA
SDVWSFGVTMYELITYCDTSKSPMQLFHGMIGRSQGQMTIIRLVKALAEGKRLPRPLEGC
PEPVYELMRKCWENAPENRISFKNLVDELTRMQQRLQP
Download sequence
Identical sequences G3NVW0
ENSGACP00000009479 ENSGACP00000009479 69293.ENSGACP00000009479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]