SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009481 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGACP00000009481
Domain Number - Region: 581-626
Classification Level Classification E-value
Superfamily Eea1 homodimerisation domain 0.000641
Family Eea1 homodimerisation domain 0.0066
Further Details:      
 
Domain Number - Region: 435-481
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0812
Family Ubiquitin-related 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009481   Gene: ENSGACG00000007163   Transcript: ENSGACT00000009501
Sequence length 753
Comment pep:known_by_projection group:BROADS1:groupXX:8103321:8110851:-1 gene:ENSGACG00000007163 transcript:ENSGACT00000009501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEWRTPAVSEKFQSRFGRRPGTADSGDTGLGTSASDSTEDFCSSSSSPPFQPIRSQIPIP
TAHVMPSTAGAPASKPHSRTPSGSTSKSSPLSKSVSSPNLDAPPAVGGDHVGPKPDCLSR
YRSLVNGLDHSLFPSDHTRMDECQKFDTPAVEPTLNQSALLGGLCPDVRLRLQTTGIRET
PDCISEAYRGGLEHSYKVLPEARSGLPGQAETLVQRGSQPGAAGSAGVYANPLSLQTQAL
LREHAGSKGYEPLRQDRCAELSSWQQQQQHKHQLESLRMQVEQMQLMSAGVSQYPSLYSS
PAHAESGKWDALVKASESLLKEKELIIERQKQHMTQMEQRLRETELQVHGALLGRGASYG
DMCMLRLQEAQRENAFLRAQFTERTDCVVLEKVEAERRLGAVEAETRRLTDCLKEACERH
AEEMKKQEERIRSRDKHINNLKKKCQKETELKRENQQRIETLERYLADLPTLEDYQSQNK
QLVEAEQQASHLQERLRELEVCLETTRSQLREKDTQLEDQKRRERDLLTTITDMQQRVQQ
GLEDGARLPSLDMEKFRGENNALREVIEKQHRMMEQLGSQIQALEEQLSQEESSSQALRE
DVLAKEKNVMELHAAMRELSAQNQELMEQNLTLREQMSEPEQKSTNQASSGLQPAGTRLT
QRLHVEIASCLGDLRSLCSILTQRAQGQDPNLSLLLGLTSPPPVAEQTEDWMNPEVLQKK
LLEAQQLRRDVEELRNVILDRYAQDMGENCITQ
Download sequence
Identical sequences G3NVW2
ENSGACP00000009481 69293.ENSGACP00000009481 ENSGACP00000009481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]