SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009520 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGACP00000009520
Domain Number - Region: 21-75
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00176
Family PHD domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009520   Gene: ENSGACG00000007193   Transcript: ENSGACT00000009540
Sequence length 102
Comment pep:known_by_projection group:BROADS1:groupXI:3938577:3939402:-1 gene:ENSGACG00000007193 transcript:ENSGACT00000009540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVWTSGVYLVNGRLYGLQEALDGARETCCSYCEMVGSTLGCYSKGCTLRYHYLCAIEADC
SLNKDNFSLRCPKHKPPPPSFVQFTQSIRPAKPVYLEQSERG
Download sequence
Identical sequences G3NW01
69293.ENSGACP00000009520 ENSGACP00000009520 ENSGACP00000009520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]