SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009537 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009537
Domain Number 1 Region: 145-700,879-1071
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.59e-234
Family Motor proteins 0.00000000695
Further Details:      
 
Domain Number 2 Region: 2010-2199
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.28e-54
Family BCR-homology GTPase activation domain (BH-domain) 0.0000743
Further Details:      
 
Domain Number 3 Region: 1946-2003
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000015
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0039
Further Details:      
 
Domain Number 4 Region: 17-114
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000551
Family Ras-binding domain, RBD 0.011
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000009537
Domain Number - Region: 1114-1170
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000152
Family Motor proteins 0.046
Further Details:      
 
Domain Number - Region: 1081-1120
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0263
Family Motor proteins 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009537   Gene: ENSGACG00000007186   Transcript: ENSGACT00000009557
Sequence length 2395
Comment pep:known_by_projection group:BROADS1:groupXIX:8353448:8410496:-1 gene:ENSGACG00000007186 transcript:ENSGACT00000009557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAACGSMRRRLEDQEFALRVYPGALAEGTIYCPVGGRKNTTAAEAIECLIERLRLDRTK
CYVLAEVKEFGGEEWILNPGDCPVQRMMLWPRSALENRGGLGSGDDYRFLLREKNLDGSI
HYGGSLQMWLRVTEERRRLVERGFLPQPAGSDPPSDLCALPELTERTILESLRARFRQEK
IYTYIGSILIVINPFQFLPVYNPKYVKLYDNHALGKLEPHIYAVADVAYHAMLQRRKNQC
IVISGESGSGKTQSTNFLIHHLTALSQKGFASGVEQIILGAGPVLEAFGNAKTAHNNNSS
RFGKFIQVNYQESGTVRGSYVEKYLLEKSRLVYQEHNERNYHVFYYLLAGASEDERKSFH
LLKPEEYHYLNQMTKKSHKLHWDNYYESELDCFTVEGEDLKHDFERLQLAMEMVGFLPTT
RKQIFSLLSAILHLGNIRYKKKTYRDDSIDICNPEVLPIVSELLEVKEEVLLEALTTRKT
VTVGERLIVPYKLAEAGTVRDSMAKSLYSALFDWIVFRTNHALLNNKDLEDNSKILSIGV
LDIFGFEDYEIFKLEQVCVGTLYQSEEAQHHLRQTRYLHLEQEEYRAEGINWHHIEYIDN
SGCLNLISKKPTALFHLLDEECNFPQASNQTLLDKFKRQHEGNSYIEFPAVMEPAFIIRH
YAGKVKYGVKDFREKNTDHMRPDIVALLKSSKNAFVCSLMGIDPVATFRWAVLRAYFRAL
VAFREAGRRHIHKKSGNDAAVPCAVVKTVDSFSFLQHPVHQRSLEILQRCKDEKYSISRK
NPRTPLSDLQGTNGLNEKASWDGYGVGCNGRSSRSGRLSSTGSPALEEDGIFLNSTSSKL
LERAQGILLRNKNVKTKPSLPKSTQHLLDVKSLRYLSSVTLHDRITKSLLHLHKKKKPPS
ISAQFQASLNKLMETLDQSEPYFVKCIRSNAEKLPLRFSDSLVLRQLRYTGMLETVRIRQ
SGYSIKYTFQDFVRHFHVLLPRDTSATKSGIREFFRRIHLPPAGYQVGNTMVFLREAERQ
RLQALLHQEVLRRIVTLQRRFRAVLERKRFVDVRRATFVIQRWWRVRLLRQSSVDSADEE
EAAVCLQAAWRSYRERRRFLERRDSAVVLQRSWRRRCRRRCEAAVTVQAAWRGFRERSRY
SRTCGAVTRLQAMARGHMARLRFREVKEQCRRLSPPAETDTGDVEDLASSGQEADAQDVS
VDPPEDSASAALDSGETEREEDSERSRSTDEPSHRNRSKRASRRMRELEQAQFSLELLKV
RTTSVQEDSAPGGDSCQLGDPHGHSPWGSPASRGSLELLDVEDMEADGSGGFGSKPTDPR
ERPRAPGVQKESPVEEREEPLAALTLEGGASSTGSQATRGEASEVVPEVEQPPGTATQAE
GDAPGTDPPPTASDPSLESGLCSSEVDIQIVPGPKDDVPAVPPGQRERKAVRPQQEAPSP
VLDTKPPKATRKSSAQTVIVNMVEKPPNTVFSNLSEVLNKEVIEKSRKRASYLYECEILI
EQHCFMLILKKRNVWAIVQTSPAKYFFKLPMSVYLCARSDKDLVNQERSLAMFRDDSKSG
SRSREVGQTHTYAHKHTLDSIRTLCAFSRKSQCMKCDYVAWKQVGRPGPKKKARMSRTRS
DFLTRCNSEGATQSDDDDEYYIPVHSRTLPPSPPSLNAHPEADCHSDPDMSVDGQKKIHK
TMSSGDLGKVEVLRKTSSQDGSRMRGRIRFWSKTKHGEKKLSREKQASGSEAAETHGNSS
LNNSNPQSNSTLPEAPSSPPHSPDLEAAPSGGLRDSKENKEPSPKMRRRRSVKISSVALE
PAQWQNDALHILSSAHDYRTMNDFLMKKIADLESEDGKKDTMVDVVFKKALREFRINIFN
SYSTALAMDDGKSIRYKDLYALFEHILEKTMRLEQRDWCESPVKVWVNTFKVFLDEFMTE
YKPAEGTIGRAPKRERKKSRKKETDIVEEHNGHIFKSTQYSIPTYCEYCSSLIWMMDRAC
VCKLCRYACHRKCCSKMTTKCSKKYDPELSSRQYGVELSRLTSEERAVPQLVEKLINYIE
MHGLYTEGIYRKSGSTNKIKELRLGLDTDVSVVSLDDYNIHVIASVLKQWLRDLPSPLMT
FELYEEFLRAMGQPDRREVIRGVYSVIDQLSRTHLSTLERLIFHLVRIALQEETNRMSAN
ALAIVFAPCILRCPDTIDPLQSVQDISKTTACVELIINEQMSKYKARLKDINSLEFAESK
AKSRLSHIRKSMKPVLIAIRFMSITRTSTPNKGHFRQSGTRTPSPPLSPKVAPVVVMDGE
NAEEAGLNEQQQQAMQREERILTEQIESLQKEKEELTYEMLILEPRTSDDDTPESEASIG
TADSSENITMETEGATSDPSERGPYPSRKSESKSRRAFSRQPDSQDSVGPLLTSC
Download sequence
Identical sequences G3NW18
ENSGACP00000009537 ENSGACP00000009537 69293.ENSGACP00000009537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]