SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009541 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009541
Domain Number 1 Region: 157-247
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.84e-19
Family Ubiquitin-related 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009541   Gene: ENSGACG00000007189   Transcript: ENSGACT00000009561
Sequence length 256
Comment pep:known_by_projection group:BROADS1:groupVI:8353733:8359634:-1 gene:ENSGACG00000007189 transcript:ENSGACT00000009561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWQANYRRMHHLADWISGTVMGGCVGRSSMEGQQGSARSSTRSKKRGGRNEPLKKERPKW
RSEYPMTEGQLRSKRDEFWDTAPAFDGRKEIWDALRAAALAAECNDLELAQAIVDGACIT
VPHGSLTESYDELGNRYQLPAYTLAPPVNLISETSSESKVSDATQKQAQPPPCRQEFQLR
VRLSTGKDLRLTASMADSIAELKKQLEKKEEISISRQRWFFSGKLLTDKTRLQDANIQKD
FVVQVILNMNSPVVVN
Download sequence
Identical sequences G3NW22
ENSGACP00000009541 69293.ENSGACP00000009541 ENSGACP00000009541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]