SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009560 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009560
Domain Number 1 Region: 5-367
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.6e-131
Family Motor proteins 0.0000000000359
Further Details:      
 
Domain Number 2 Region: 535-640
Classification Level Classification E-value
Superfamily SMAD/FHA domain 5.68e-27
Family FHA domain 0.0000102
Further Details:      
 
Domain Number 3 Region: 1609-1672,1708-1805
Classification Level Classification E-value
Superfamily PH domain-like 7.12e-24
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000009560
Domain Number - Region: 1137-1208
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.048
Family PLC-like (P variant) 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009560   Gene: ENSGACG00000007205   Transcript: ENSGACT00000009580
Sequence length 1826
Comment pep:known_by_projection group:BROADS1:groupXII:9399255:9444414:-1 gene:ENSGACG00000007205 transcript:ENSGACT00000009580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGASVKVAVRVRPFNSREMGKESKCIIQMQGNTTTILNPKAPKEPAKTFSFDYSYWSHT
TPEDPCFASQNLVFNDIGKEMLAHAFEGYNVCIFAYGQTGSGKSYTMMGKQEEGQEGIIP
MLCEDLFEKIDDVSNKEELSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVE
DLSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQKKHDSETDISTE
KVSKISLVDLAGSERADSTGATGTRLKEGANINKSLTTLGKVISALAEVTQDNCTSKSKK
KKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKNIKCN
AVINEDPNNKLVRDLKDEVARLKELLRAQGLGDILDIDPMGDDCPGSGIKYLKDIQNNKN
RYLIASENQRPGHFSTAPIGSLTASPSSGSLCNQGGLQSVTSIQERIMSTPGGEEAIERL
KESEKIIAELNETWEEKLRKTEAIRMESREALLAEMGVAIREDGGTLGVFSPKKTPHLVN
LNEDPLMSECLLYYIKDGITRVGQADAERRQDIVLSGAHIREEHCIFRSERNANGNVIVM
LVPCEGSETYVNGKRVEDSIQLRSGNRIIMGKNHVFRFNHPEQARAEREKTPTAETPVEP
VDWTFAQRELLEKQGIDMKQEMEKRLTEMEILYKKEKEEADQLLEQQRLVYESKLQELQK
QVETISLVAETPPEPKLLGSVPWTPHEFELAQWAFRKWRYHQFTSLRDQLWGNAVYLKEA
NAISVELKKKVQFQFVLVTDTLYSPLPSELLCPEADKEQDSRPFPRTVVAVEVQDLKNGA
THYWSLDKLKQRLEQMREMYDRAGEMASTNPEDGEGTLTGNDPFYDRFHWFKLVGSSPIF
HGCVNEHLADRTPSPTFSTTDSEITELADERQSEMSDLIDDEAFVDDTSSDAGTEEGSDI
FSDGQDPFYDRSPWFILVGRAFVYLSNLLYPVPLVHRVAVVTEKGEVRGFLRVGVQAIAA
DEEAPDYGSGVRQSGTAKISFDDEYFKKNDFPSTVMTHSGLSQEELRFVEGQGQSSEVIT
PSEELNRINDMDLKLGNVADTKLSCGDDLAGQLEVGSIFTFRVTVLQANGVPPEYADIFC
QFNFLHRHDEAFSTEPLKNTGKGAPLGFYHVQNISVEVTESFIEYIKTKPIVFEVFGHYQ
QHPLHLHGQDLISPPTPSRKYYPIPMPLSKPVAATKLNTITKSNLGQCVSKYDLLVWFEI
SELEPTGEYIPAVVDHSGGLPCNGNYLLHQGIQRRITVTLIHEKGSELHWKDVRELVVGR
IRSKAEVDESAADAVLSLNIISAKNIKSSHNSNRTFYRFEAVWDSSLHNSLLLNRVTPYG
EKIYMTLSAYLELDHCIQPAIITKDICMVFYSRDAKISPPRSLRNLFGSGYSKTPDCNRV
TGIYELSLCKMSDSGSPGMQRRRRKILDTSVAYVRGEENLAGWRPRGDSLILEHQWELEK
MEQLHEVEKTRHLLLLKERLGDDAPLGTAPTPKSLSGLLSPSMSTDSLSTSTSISSQISS
TTFESAITPSESSGYDSADIESLVDREKELATRCLRLLTHTFNSEYNQVVNSISDCKLSD
ISPMGRDPSVTSFSSATLTPSSTCPSLSDSRCGSMDQKTPENSSRASSPSCSDYENFPMV
PTLESSYLARAGKNEFLNLVPDIEEMRPGSVVSKKGFLSFMEPRSNSWVKHFVVVRRPYV
FIYNSDKDPVERGVLNLSTAQVEYSEDQQAMLKTPNTFAVCTKHRGILLQANNEKDMNDW
LYAFNPLLAGTIRSKLARRRSGLMKK
Download sequence
Identical sequences G3NW41
ENSGACP00000009560 69293.ENSGACP00000009560 ENSGACP00000009560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]