SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009590 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009590
Domain Number 1 Region: 15-112
Classification Level Classification E-value
Superfamily PH domain-like 6.16e-25
Family Pleckstrin-homology domain (PH domain) 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009590   Gene: ENSGACG00000007243   Transcript: ENSGACT00000009610
Sequence length 529
Comment pep:known_by_projection group:BROADS1:groupXI:4090226:4098101:-1 gene:ENSGACG00000007243 transcript:ENSGACT00000009610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVLFAPQPDLLNFKKGWMSKLDESGEWKKHWFVLTDAGLKYYRDSSAEEKDDLDGEIDL
KSCVKVCEFDVEKNYGFQVQTREAAHTLSAMTAGIRRNWIEVLKKCIRPGSSPDLTQLPD
GSSDKENSHSRFPPASRRPASRHADAVQPDSAAPAHRRFDCVELSPVPAPAGRREAAEGQ
GREHVQWQEERNTSSQWEAVLSRKGTGGGSNHRARSEDEIESKWAEFERLPLKEMSSLPP
MGSRSSSQSANEALQREVASLRQQLEQLQGGPEAPCGRSLVAMERAHRQAMEELQKQHDR
QLKELEAEQERRLQEETRDTARVMEALKKKLKDELEKEVERVRRLSSGGLDSRTMRGQQQ
EETQGLQRELAGLSERYSQKCLELNRAEQNSAEREREISRKERDMEQLRKENQDLKARLA
AEISRSRSSVSHHGSENSKDRTPCELEVLLRVKENEIEYLHKEISCLRNELQFLNTEKRL
AGERYAEVMEQLSGMKGRSEREIQSLKEHLRLAMAALQEGQKLGNSLDH
Download sequence
Identical sequences G3NW71
ENSGACP00000009590 69293.ENSGACP00000009590 ENSGACP00000009590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]