SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009701 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009701
Domain Number 1 Region: 682-1032
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.76e-91
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.0000000754
Further Details:      
 
Domain Number 2 Region: 497-677
Classification Level Classification E-value
Superfamily ARM repeat 2.59e-54
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.0000644
Further Details:      
 
Domain Number 3 Region: 106-287
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.5e-48
Family Ras-binding domain, RBD 0.0064
Further Details:      
 
Domain Number 4 Region: 327-479
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.5e-45
Family PLC-like (P variant) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009701   Gene: ENSGACG00000007313   Transcript: ENSGACT00000009721
Sequence length 1041
Comment pep:known_by_projection group:BROADS1:groupXII:9537811:9549763:-1 gene:ENSGACG00000007313 transcript:ENSGACT00000009721 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPGKYGMQEEWEKEWDQQIGMEFLLPTGIYLKFPVSPNDTIKSIKKMVWKNASSEALFS
ALGDPEAYVFTCINQTAEREELEEESRRIRDVRPFMCVLRLVAREGDRVEKLTNTQISLL
IGKGLHEFEAQKNHEVNEFRAKMRAFCEETAQERQMLPWQQWMEYSFPCELEPCCSPCGF
GRVKSKNKKKIFINVKFDACDESFMVQQDPQDLPVALMRSALKKKAAVFPTLRQEPQDYT
LQVNGRWEFIYGKHPMCQFKYIFSCLRNGENPYLTMVHHSAIHKYQEEQGRMCSQLYKSR
SLSRPPPLPLKKQNTSSLWSIREPFYIHLLQGSRVNAGEGMKLVVQAGLFHGSELLCKVM
TTSEVSVCSEPLWDQKLEFDINVADLPRMSRLCFALYAVIEKAKKPRGTKKKNKKADCPI
AWVNTMVFDYKDQLKTGEFLLSTWPSVPADKSDLLNPMGTVEKNPNVDSAAGLLIRFPNI
RPHPLYYPPLDKLSGDMEKNGDATVATKEEYLKLKEIMDNKNSTEFFEDEKELLWKLRTE
VRDRFHESLSKLLLVTKWNRHEDVVQMVSLLRNWPDLPAIHALELLDYSFPDPAVRSFTI
ACLRKLSDDELLQYLIQLVQVLKYESYLDCDLTTFLLERALSNWRIGHFLFWHLRSEIHV
ASVSLRFGLILEAYCRGNIHHIRLLTKQNEALGKMKALSDFVKSGSQKMTADDLKLCIRQ
ESYLEALSDLLSPLNPSISLADICADKCRFMNSKMKPLWLMYNSGAQGDTVGIIFKNGDE
DLRQDMLTLQMIQLMENLWKREGLDLRMLPYGCLSTGNKMGLIEVVKNSDTIANIQRNSS
NSAATAAFNKDALLNWLKSKNPEDKLDPAIEEFTLSCAGYCVATYVLGIGDRHNDNIMIR
ETGQLFHIDFGHILGNFKRKLGINRERVPFILTYDFVHVIQQGRTNNSEKFERFREYCER
AYKILCRNAMLFVNLFAMMKAAGLPELTSFKDIQYLKDSLALGKSEEEALKNFKVKFNEA
LRESWKTKVNWMMHSLAKDNR
Download sequence
Identical sequences G3NWI2
ENSGACP00000009701 69293.ENSGACP00000009701 ENSGACP00000009701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]