SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009718 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009718
Domain Number 1 Region: 573-646,693-849
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.01e-55
Family Tandem AAA-ATPase domain 0.00012
Further Details:      
 
Domain Number 2 Region: 328-568
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.32e-55
Family Tandem AAA-ATPase domain 0.00014
Further Details:      
 
Domain Number 3 Region: 104-156
Classification Level Classification E-value
Superfamily UBA-like 0.000000000986
Family CUE domain 0.038
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000009718
Domain Number - Region: 245-279
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.00216
Family ComEA-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009718   Gene: ENSGACG00000007327   Transcript: ENSGACT00000009738
Sequence length 872
Comment pep:known_by_projection group:BROADS1:groupXIII:6529980:6538168:-1 gene:ENSGACG00000007327 transcript:ENSGACT00000009738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSSKNAALDHTDAEDDELNDKMSSILEMFPQLTRTDLLEIIGSTSTLEGAVAACLLRFGD
KEAPDHGRKRKLDGSSSSQDSAEAQSSKRSKRTVVGFNANDDAEPSWEKQEAMVRRLQKK
FPDQDKEELRMVLQEHEWNVEDALQVLQMFSDPDDTSFSSPDTEEKKSTAQMLSRFASGT
SIAKKQAAERKRKARDSNEHVSSEEENDAEEETVSSEFEDSDEELDSTGGMTDLKKEILD
FFRDASIDELSLIAGCSVKKAQKIVELRPFDSWQSLADAFVKDKGLSDSLLLGCRVVLKE
RKVVLGLMSKCNTISSKMVRQVTEVMESGTGTLKQPALLNSQNQLKPYQLIGLKWLLLLN
EHKLSGILADEMGLGKTIQAIAFLAQLYERGVDGPHLITVPASTLDNWVRELKLWCPSLK
VLVYCGSVEDRRYLRHDLLNDDVDCNVIVTTYNMAIGNDSDRSLFRKLRLKYAVFDEGHM
LKNMNSLRYRHLMAINAEHRLLLTGTPLQNNLLELMSLLNFIMPSMFSSSTTQLSKMFSM
NSHEEQSRFERDRISQAKLIMKPFILRRVKSEVVLKQLPAKEDKVESCPMSEKQQALYQT
LFDKLKASTNGESKERELCNVMMQLRKMANHPLLHRHYYTTEKLKAMSKLMLKEPTHFDA
DAALIQEDMEVMSDFELHRLCKQYSSISSYQLENNLLLDSGKFHHLTELLASHKNKGDRV
VLFSQFTMMLDIVEVLLKHLKHRYVRLDGSTPIADRIGLIDEYNTDPGIFVFLLSTRAGG
LGINLTSANVVILHDIDCNPYNDKQAEDRCHRVGQTKIVKVIKLISKGSIEDCMLQLSQK
KLKLEQDMTAAEGGEGTIPEDMASLLKASLGL
Download sequence
Identical sequences G3NWJ9
69293.ENSGACP00000009718 ENSGACP00000009718 ENSGACP00000009718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]