SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009814 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009814
Domain Number 1 Region: 29-179
Classification Level Classification E-value
Superfamily PH domain-like 4.25e-45
Family Phosphotyrosine-binding domain (PTB) 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009814   Gene: ENSGACG00000007390   Transcript: ENSGACT00000009834
Sequence length 297
Comment pep:known_by_projection group:BROADS1:groupXV:4337116:4357518:1 gene:ENSGACG00000007390 transcript:ENSGACT00000009834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDALKSAGRAIIRSPSIAKQSWTASRHRKLPENWTDTRETLLEGMVFQLKYLGVTMVEQP
KGEELSAAAVKRIVATAKASGKKLQKVTLTVSPRGIILYDSASNQLMENISIYRISYCTA
DKMHDKVFAYIVQSQHNETLECHAFLCTKRKMAQAVTLTVAQAFRVAFEFWQAAKEEKEK
RVKSGSDGEGASNSQSDSSASLGSLKAGEVATARLLDLAEGANAALVHSASKQMESDPFM
VHNHATENNNTVWELEDGLDEAFSRLAESRTNPQVLDIGVNPQDFNTEECLSPGRWD
Download sequence
Identical sequences G3NWU5
ENSGACP00000009814 69293.ENSGACP00000009814 ENSGACP00000009814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]