SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009995 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009995
Domain Number 1 Region: 209-348
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-37
Family Third domain of FERM 0.0034
Further Details:      
 
Domain Number 2 Region: 106-211
Classification Level Classification E-value
Superfamily Second domain of FERM 6.02e-31
Family Second domain of FERM 0.0000615
Further Details:      
 
Domain Number 3 Region: 24-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.41e-27
Family First domain of FERM 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009995   Gene: ENSGACG00000007535   Transcript: ENSGACT00000010017
Sequence length 603
Comment pep:known_by_projection group:BROADS1:groupXIII:7189135:7225442:-1 gene:ENSGACG00000007535 transcript:ENSGACT00000010017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTDRRMKMLRFRSPSIRSLDQEVLCTIRLLDDTEISCSIQRDTKGQFLLDHVCNHYNLLE
KDYFGIRYVDPERQRHWLEPNKPVVRQMKSHQPYTMCFRVKFYPHEPMKIREELTKYLLY
LQLKRDVYHGRLLCPFAEAAYLGACIIQAELGDYDPEEHPSDYIRDFKLFPKQSLKLERK
IIEIHKNELRGQSAAFAELNMLQRAHSLETYGVDPHPCKDFTGSTAFLGFTATGFVVFQG
NKRIHLLKWADVSKLKFEGKTFYVIGVQKEKKLVLTFHTSTPAACKHLWKCGVENQAFYK
CAKSSQIKTVSSSNIFFKGSRFRYSGRVAKEVIEASSKIQREPPDVRRAQFGQSRSFNSL
SHKNLIINMEPLVPALPSTNEYEETAADAAGVVAVKDSVPLSPLKPAAPADTQQQSSETP
KAEDDVVEDDEASGSLTISELVYSPCASMLPTPVDDSQGGVDLLFSSPVQSPARMLRELH
ADPDIQAQLQAERERDRARERTRAAARGGMGGALASSLRLLSSNERFNACVLSAARFVGV
VMGILLVTVPTLLLLLESDIDVSFLHEIRQTPEFEQFHYEYYCPLRRWVLCRISMAMENL
WSD
Download sequence
Identical sequences G3NXC6
ENSGACP00000009995 ENSGACP00000009995 69293.ENSGACP00000009995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]