SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009999 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009999
Domain Number 1 Region: 61-118
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000426
Family UBA domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009999   Gene: ENSGACG00000007544   Transcript: ENSGACT00000010021
Sequence length 119
Comment pep:novel group:BROADS1:groupXIII:7231667:7233267:-1 gene:ENSGACG00000007544 transcript:ENSGACT00000010021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEALLLIQQGLQTLAAEAPALIPTAGVNAAPELVPDSVLHSQCGHRVSMVTAQQQQQFVE
QMLQALADTNHGVHVDEAEFQDELEHLSSMGFGDREANLQVLISTGGDLTTAIQHLLSL
Download sequence
Identical sequences G3NXD0
ENSGACP00000009999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]