SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010054 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010054
Domain Number 1 Region: 296-619
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.81e-78
Family p120GAP domain-like 0.00011
Further Details:      
 
Domain Number 2 Region: 578-717
Classification Level Classification E-value
Superfamily PH domain-like 1.01e-37
Family Pleckstrin-homology domain (PH domain) 0.0016
Further Details:      
 
Domain Number 3 Region: 148-305
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.61e-24
Family Synaptotagmin-like (S variant) 0.011
Further Details:      
 
Domain Number 4 Region: 15-134
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.65e-21
Family PLC-like (P variant) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010054   Gene: ENSGACG00000007520   Transcript: ENSGACT00000010076
Sequence length 822
Comment pep:known_by_projection group:BROADS1:groupI:5766408:5786885:1 gene:ENSGACG00000007520 transcript:ENSGACT00000010076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEDDATVRILQSLRGKICEAKNLGPVSGPNRQRDLCTLCTISLDQEEVFRTKVFDKSVSP
FYGEDFYFEIPRPFQCLSFYVYAKSVFQRDLPVGKVSIRKDDLCKYSGKEHWFSLHPVDP
NSEVQGKVHLEMRLNEVITVTGSMGQHLLVRIIECQGLPLISGQNCDPYATVSLVGPARS
DQKKTKVKKKTSNPHFEETFSFEVTRSGSYSKKTHFQVEEEDIEKLEIKVDLWNNENLAQ
DVFLGETRVPVKILRNSHIHKAWYLLQPKGNGSKSKSDDLGSLRLKLTYIEDTVLPSACY
TPLCNLLLKSPDVKPISASAAHILGDICRERYEAVLPTVRLLLHHNRFVPFVSAVAALEL
DNTQEANTIFRGNSLATRCIDDMMKIVGKNYLAVTLKPVIDEICESNKTCEIDPVKLKEG
DNTEVNKENLQGYVQKVFSSITQSSSSCPPLMCDVFRSLRHLACKRFPADPHVQYSAVSS
FVFLRFFAVAVLSPHSFQLRSHHPDTEISRTLTLISKTIQTLGSWGSLSKKMSSFKETYM
YDFFKSFQEDKCIEKVKKFLDEISSNISKESSGLEDAVVLKEGEVQKRGQGRKHLGKKNF
KKRWLRVTNRELSYHKHKDLGKEALCIIDVKNIQAVEKLDESAFNRKNMFQVLHSEKPLY
VQAGNCVEASEWLEVLGPVSRCNEGRLSAFHPSNYTGGAWQCCRSQSSNAPGCKPCTTTV
LANLQLDIDCDRETERIFSLLSSNDTKLQNMEDACASMAVYQGPQREQEDYSKFTIQEPK
ETFQTLKQLRNVMEELQKQHDVRSDTTAQYGSLDNPIVGKTS
Download sequence
Identical sequences G3NXI5
ENSGACP00000010054 69293.ENSGACP00000010054 ENSGACP00000010054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]