SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010057 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010057
Domain Number 1 Region: 1-674
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.95e-219
Family Motor proteins 0.0000000000849
Further Details:      
 
Domain Number 2 Region: 676-755
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000372
Family Type II thymidine kinase 0.09
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000010057
Domain Number - Region: 933-996
Classification Level Classification E-value
Superfamily PH domain-like 0.0664
Family Third domain of FERM 0.069
Further Details:      
 
Domain Number - Region: 754-808
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0982
Family G proteins 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010057   Gene: ENSGACG00000007578   Transcript: ENSGACT00000010079
Sequence length 1084
Comment pep:known_by_projection group:BROADS1:groupXVI:14827472:14849263:1 gene:ENSGACG00000007578 transcript:ENSGACT00000010079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YALADEAYRSLRDQDKDQCILITGESGAGKTEASKLVMSYVAAVCGKGQEVNKVKEQLLQ
SNPVLEAFGNAKTVRNDNSSRFGKYMDIEFDFKGDPLGGVISNYLLEKSRVVKQPRGERN
FHVFYQLLSGASDDTLKKLKLDRDFSKYNYLSLDSAAVIGLDDAANFRTVKNAMQIVGFM
EDEVQSVLQLVAAVLKLGNIEFKPESRSNGTDESRIKDKNDLKEMCELLGIEQSVLERAF
SYRTVEAKQEKVSTTLNVAQAYYARDALAKNLYSRLFSWLVTRINESIKAQTKARHKVMG
VLDIYGFEIFEADSFLRMLMNVCREGRMKIFIELTLREEQEEYVREGIEWTNIEYFNNAI
ICDLIENHQNGILAMLDEECLRPGTVTDETFLDKLNTICAGHKHFESRQSKNSKFLTDHS
LPHNCFRIQHYAGKVLYRAEGFVDKNNDLLYRDMSQAMYKAKHSLIKQLFPEGNPAKVNL
KRPPTAGFQFKASVGTLMRNLQTKNPNYIRCIKPNDKKASHIFTDTLVCHQVRYLGLMEN
VRVRRAGYAFRQAYEPCLERYKMLCKRTWPHWKGPAREGVEVLMADLQVPADDFSYGRSK
IFIRNPRTLFSLEERRRQCLQDLATLIQKIYRGHKCRSHFLLLKKSQIVVSAWYRRYAQE
KKYQKIKSATTVVQSYTRGWQARKLLRELKYQKRCEEAVTTIAAFWHGTQARMELRRLKQ
EAQNKHAVTVIWAFWQGTKARRELRQLKEEARNKHAVSVIWAGWQGTKARRELRRLKEEA
RRKNAVALIWAYWQGLKVRRDYRKFFRANAGKKIYDFTIQRIMQKYFLGLKSTSPPMSPV
DKSWPARPYRFLDGVHAELRKIFHHWRCKKYRSQFTEEKKAVYKEKLEASEIFKDKKALY
PSSVSQPFKGDYLEITKNPKYQKLNSSVDAKVLLADVVNKINRANGKGTARIFLLTKKGV
VLADQKTGQVKASVPLPDLASVSVSTQNDGFFALKLKEGSASAIKGDFLLSSERLIEIIT
KLHLTGATAADSERLNIDISDEFLVQFNHDKVCVKFIQGAARNGNGVSCKRKNNRLLEVS
VPTT
Download sequence
Identical sequences G3NXI8
ENSGACP00000010057 ENSGACP00000010057 69293.ENSGACP00000010057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]