SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010144 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010144
Domain Number 1 Region: 2192-2346
Classification Level Classification E-value
Superfamily SET domain 8.76e-46
Family Histone lysine methyltransferases 0.0081
Further Details:      
 
Domain Number 2 Region: 283-351
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000137
Family PHD domain 0.018
Further Details:      
 
Domain Number 3 Region: 371-444
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000332
Family PHD domain 0.018
Further Details:      
 
Domain Number 4 Region: 240-293
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000509
Family PHD domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010144   Gene: ENSGACG00000007639   Transcript: ENSGACT00000010166
Sequence length 2346
Comment pep:known_by_projection group:BROADS1:groupXX:8927917:8940373:1 gene:ENSGACG00000007639 transcript:ENSGACT00000010166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GYRSRRCGVCKGCNHEDDCGECMNCLDKPKFGGPNTKRQCCVYKRCDQIEERKARRLSGR
TAPKASHQQAASVFLFKGASKRRRSSFGHSSNDEGNEGGADSPFGLQGDGHSPSVRKQPK
RVVKPRVYFDLVDYDSDLDDKAASSFASPGRRRGTGSRFNQDEEVRHRKSSSHRVPPPRP
PPRKPEKTPPSVLAALAHGFEQRDTESSKPSHKIRVDFKEDCTLENAWNMGGLSILTSAP
PTPPSVCFLCASKGQHEMLYCQVCCEPFHEFCLDPADRPSEENKENWCCRRCKFCHVCGR
KNKPSKPLLECERCQNCFHTSCLGPNYPKQNKKRKAWVCMTCIRCKSCGVTPGKSWDTDW
NHDKGLCPDCSKLNELGNYCPICFKCYEDNDYDSQMMQCGTCNHWVHAKCEDLTDELYEI
LSSLPESVVYSCRPCSVTQPSAWRELLYIELRSGVEKVLACLLSSTLTQHLVACSQVRDW
AFILLRIHYDITMRQSHDNPCEKLVDSGSALEGQPACDLRAVGKKFDRGLYTTLKMFHED
VVQVVRKRLEHEEDLPEEQRPTALARSYYLKLLEEVFNWFNSQDPKVWNSCTKELPMGML
SHAVHPPTTEHVYAQFQEREDLSSRAPLGLLQGEDRQSLIVKEEEAVSPLSGEPISQNYF
KSSKAVRLKFKGKRGLLSKADLDTGWTKDDERQCSLCQKYGDLKPNDAGRLLYLGQNEWA
HVNCCLWSAEVFEEDNGSLLHVHSAATRGRLMRCERCNQTGATVGCCLTSCQSNYHFMCA
RSRHCVFQEDKKVYCYKHRHLISGKMVTGQEFEVNRRVYVDFEGISPRRKFLTGLEPELI
NVIIGSLQIEQLGVLTELSASKGILFPVGFKCSRWYWSTVNPMRRCRYTCTVREVRPVVP
EKPVEEMPDQGDNNTIVHSPCPLSANESDSEAQENDITEPQPPTEETFIPGPTSKSDHGA
KPKIPRRPTGGMFRPLPSPGMKQLKPHHILTISDLEDTQRVLRHNPHFQPTGLHSHMPPP
PLGPLTGPVTLRAGKSSVPTSPLLPLGAPDNLINSPSSRSVAGRNASSVRCPGNTMTHCT
SSLFPQSPWQDSAASFPSPSLSFSPTIPHLPRNRLSFDLNQPDSVEVPHNFLASPEPEDV
SPANGTSPQGDVEQRKEVEEFPYSSFLKDSNVSLAQEMRTELEIEETLLNEGVAMNCGGQ
ILVGGDDREEFWERAQEVHKRKTLVANLPRSAASARDDLSNTSSDDDMEHYFDFSRTIVS
CPASKDHSKSPSSPSTRSMAQLDGVDDGTESDASVATTEVAQKVQDGSKAPIQAQLLKNT
PESNTTNSTQGVQSLGPKASSNEQRTDSSAVTMSVANKSQTYDSYQDPPKSPPLNSEDLF
HGCGSGFTSETSFVLERCESRLHSAEMLEGTLLETQQYEAGKPQSCETNSSQSTVFVNHL
AANTMLPSSADSADKSQDALLELQPSPVMSTDVHNPSQGLLDSLQIFSSLPGFSKPLTNI
TLQPVTSSQELTFPSTGHSSANLTPLGPVVDVTRTLLNATPQNDPALSALPGAGPPPGTC
GTFSLPIYSTQPMCSTAVTIVSSSASMASLSVLSSQCSTAPTSVQTAAAPLILNGYSSSS
MQKDAASGHTISINFSTSRPALEPQQPVVPQALPGHAILTVKEVGGPNVDPTPHVLLVNR
LGQIFVKNPESNTFQLPSPSSSSYNCVTQIASLLQSNALSATLAAAGNMTPPATAATPPS
VQSPTTIAQLLTHNSNVAATSVDVKKPKKSAKTPKQESAVELKKAKKKKDSGVSKKSKSS
KVSAPQPGLPTENHPMTPAESAQAIINQAMASNYTPKWTGLRTLSPSSLVLPPGLLIEPE
APALSRSPPLTPTAAAAPACRPRTHVRMKRVSSLSDRIVTKKSKVNFLKPEPPSEDEEQR
RPLFPSLSSRASGVRIKTPTVKEVLDLDRLKEEHHNRSNLLYLLNHCRVPVVGLETVNNT
SSRRSEPWDYMSQGEHGQPQIWEPVGHSTLTDWKKYSGAASTSDDEPPASDEDEEFPTNR
DQPHLTFEITSDDGFSAEADSIEVAWKAVIDGVQEARAIARLRPLTFQRLTGAHMLGLVR
DAVVFLLEQLQGAHRCQRHAFRFFKQFTQEDELPVNPSGCARSELYLRKSTFDMFNFLAS
QHRQLPDTGPYDDEEDEVLLKSTRRATSLELPMAMRFRHLERTSKEAVGVYRSAIHGRGL
FCKRNIEAGEMVIEYAGIVIRSVLTDKREKYYDGKGIGCYMFRIDDFDVVDATMHGNAAR
FINHSCEPNCYSRVINVEGRKHIVIFALRKIYRGEELTYDYKFPIEDASSKLNCNCGARR
CRRFLN
Download sequence
Identical sequences G3NXS4
ENSGACP00000010144 69293.ENSGACP00000010144 ENSGACP00000010144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]