SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010199 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010199
Domain Number 1 Region: 237-490
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.15e-61
Family Decarboxylase 0.000000487
Further Details:      
 
Domain Number 2 Region: 14-205
Classification Level Classification E-value
Superfamily PRTase-like 1.57e-42
Family Phosphoribosyltransferases (PRTases) 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010199   Gene: ENSGACG00000007660   Transcript: ENSGACT00000010221
Sequence length 494
Comment pep:known_by_projection group:BROADS1:groupXVI:14989352:14992800:-1 gene:ENSGACG00000007660 transcript:ENSGACT00000010221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TCVETDEMEDGCVERLVLKLHEVSGVKFGEYTLKSGLLTPIYIDLRVLVSHPALMNQVSS
LIYQRVQDEGLQFDSLCGVPYTALPLATIICSRHELPMLIRRKEAKDYGTKRMVEGSFRQ
GDTCLIIEDTVTSGCSILETAEVLYKEGLKVTDAVVLMDREQGAAEMLASRGIRLHSLVS
IFKLLEVLQAADRIDAKTAQSVRTFILENNMFSRKDDNGNGFPPPKKTCVQRSAELSYAD
RAKLPNVHPMASRLLTAMEEKQSNLCVSADVTSSEELLRLADTLGPAICVLKTHVDILQD
YTAAFGQKLQALAEKHNFLVFEDRKFADIGNTVKHQYEGGLYQISSWSHMVNAHAVPGPG
VVKGLSAVGKPLGRGCLLIAQMSSQGSLATGEYTRAVLAMAEEQPDFVIGFICGSKITER
PEFIHMTPGVQMQAGGDGLGQQYATPEEVLYEKGSDVIVVGRGILEAPDRLKAAESYRKS
GWEAYTKRLGHSGQ
Download sequence
Identical sequences G3NXX9
ENSGACP00000010199 69293.ENSGACP00000010199 ENSGACP00000010199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]