SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010222 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010222
Domain Number 1 Region: 232-472
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 5.6e-61
Family Decarboxylase 0.000000577
Further Details:      
 
Domain Number 2 Region: 7-198
Classification Level Classification E-value
Superfamily PRTase-like 1.44e-42
Family Phosphoribosyltransferases (PRTases) 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010222   Gene: ENSGACG00000007660   Transcript: ENSGACT00000010244
Sequence length 474
Comment pep:known_by_projection group:BROADS1:groupXVI:14989978:14992764:-1 gene:ENSGACG00000007660 transcript:ENSGACT00000010244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDGCVERLVLKLHEVSGVKFGEYTLKSGLLTPIYIDLRVLVSHPALMNQVSSLIYQRVQ
DEGLQFDSLCGVPYTALPLATIICSRHELPMLIRRKEAKDYGTKRMVEGSFRQGDTCLII
EDTVTSGCSILETAEVLYKEGLKVTDAVVLMDREQGAAEMLASRGIRLHSLVSIFKLLEV
LQAADRIDAKTAQSVRTFILENNMFSRPLPPPRWGLCSGALHPRPLSSADVHPMASRLLT
AMEEKQSNLCVSADVTSSEELLRLADTLGPAICVLKTHVDILQDYTAAFGQKLQALAEKH
NFLVFEDRKFADIGNTVKHQYEGGLYQISSWSHMVNAHAVPGPGVVKGLSAVGKPLGRGC
LLIAQMSSQGSLATGEYTRAVLAMAEEQPDFVIGFICGSKITERPEFIHMTPGVQMQAGG
DGLGQQYATPEEVLYEKGSDVIVVGRGILEAPDRLKAAESYRKSGWEAYTKRLG
Download sequence
Identical sequences G3NY02
ENSGACP00000010222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]