SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010236 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010236
Domain Number 1 Region: 548-632
Classification Level Classification E-value
Superfamily Kix domain of CBP (creb binding protein) 2.22e-36
Family Kix domain of CBP (creb binding protein) 0.00000607
Further Details:      
 
Domain Number 2 Region: 1032-1158
Classification Level Classification E-value
Superfamily Bromodomain 3.66e-35
Family Bromodomain 0.000000641
Further Details:      
 
Domain Number 3 Region: 2037-2093
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 5.1e-26
Family Nuclear receptor coactivator interlocking domain 0.00023
Further Details:      
 
Domain Number 4 Region: 1710-1795
Classification Level Classification E-value
Superfamily TAZ domain 1.7e-24
Family TAZ domain 0.0000024
Further Details:      
 
Domain Number 5 Region: 321-405
Classification Level Classification E-value
Superfamily TAZ domain 7.59e-22
Family TAZ domain 0.00000628
Further Details:      
 
Domain Number 6 Region: 1646-1691
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000111
Family ZZ domain 0.00022
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000010236
Domain Number - Region: 1235-1279
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00031
Family PHD domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010236   Gene: ENSGACG00000007707   Transcript: ENSGACT00000010258
Sequence length 2411
Comment pep:known_by_projection group:BROADS1:groupXI:4720442:4744846:1 gene:ENSGACG00000007707 transcript:ENSGACT00000010258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADNVLESGPPSAKRPKLSSPALSVSASDGNDFGSLFDLEHDLPDELINSSDLGLTNGGD
VSQLHTSLGGLGGGLGLGGQDAATKHKQLSELLRAGAPGQQGGPNSNSTAPGASMGMMGG
VGVSHGGPQGQQQQAGLMQQAGMVGGAAALNRAAAMMGAQKGNTGQQQQGLMGGQVMNGS
PRMGYPGAAGMGNSSNLLAETLQQQGSQQMGHGGPAGMRPQQPGALNKMSMMANAGPYGG
PYGQSGQGLPGAGLGPQLQNKGALPNSMASQFSMDKKAPPGQGTAGMVGGVSASGAAAAG
GAQVGLSAVGAGPGAAPPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCR
TMKNVLNHMTHCQAGKSCQVAHCASSRQIISHLEKCTNPKVCRCLGSFMAIVFSFLVSLE
DGCVGLNCADSLNLVFSSITWKKSISSCIVTLHIFCLEMFCFEHKVSSSAFNNQHHPTNL
YNCNSTTLTGGNSMGVNGGVGVQSPNQQSSLLPNALLHGNMNAQSLLTDGLGNLGSMPTA
TPPSAAGMRKSWHEDITQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGDM
YESANSRAEYYHLLAEKIYKIQKELEEKRRTRLQKQGIMPGQGGMVSPGPPQVPPSMGQL
PMTPGQPPNGPHADPSMVRPSGPNQMVNRMQNPPGMSQFAQMGMQSMGQRSPLPHNSPMN
QTSYASCFQMGMGAARMGQPNATQLQNQYFPSGQFPGSSPGHGSGPIGSATAVGPMGSGS
ASGAGSQTNMPPSSAPTQNNSYPHCPPIRTNSPSPARSLTPQPHQTPPTLPRSQTPQPQT
PSALQQQQASQQQQQASQLQQQEASQQQQQASQLQQQAQQSVNSEKAMQLPQQTLCSASS
GPQGSHGSSKPTQNAHVPSQRPQTPLSPKPSLTAEGQVSSPGSVSSSANPSSQLTEADGP
APSQEDVNMEVKKQEDEDEGADTEGEGKGKMGKGQHDVKTEEKPEVATGEDKKPEVKQEP
KEEEDGAGSASNSSSPASAQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQL
LGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVEDIWLMFNNAWLYNRKTSRVYKYCS
KLAEVFESEIDSVMQGLGYCCGRKFEFSPQTLCCYGKQLCTIQRDAAYFSYQNRYHFCEK
CFNEIQSESVSLGDDPSQPQTSINKDQFQRKKNDTLDPELLVECGDCGRKMHQICVLHHD
TIWPLGFVCDNCLKKANKTRKENKYASKRLPHTKLGCYLETRVNDYIKRQNIPDSGDVTI
RVVHVSDKVVEVKPGMKSRFVDSGEMCASFPYRMKALFAFEDIDGADVCFFGMHVQEYGS
DCPPPNQRRVYISYLDSVHFFQPRQIRTGVYHEILIGYLEYVRRQGYTTGHIWACPPSEG
DDYIFHCHPMDQKIPKPKRLQEWYKKMLDKAVAERIVHDYKDVFKQATEDRLTSAKELPY
FEGDFWPNVLEESISTSNESTDITKGDSKNAKKKNNKKTSKNKSSMSRANKKKPGMPNVS
NDLSQKLYATMEKHKEVFFVIRLIAGPTANSLPPITDPDPLMACDLMDGRDAFLTLARDK
HLEFSSLRRSKWSSMCMLVELHNQSQDRFVYTCNECKHHVETRFHCTVCEDYDLCITCYN
TKGHEHKMDKLGLGLDDDSNNQAAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPS
CQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCLNIKQKLRQQQ
LQHRLQQAQMLRRRMASMQRVGQPGGNMVGLPSPPSTPTSGGTQPPTPQTPTQTMPSGTQ
QGMGPGPGLGGAVMAGNVGGQQPAGQGHPSLPQHQQQPPSGPPPAAVEIAMKIQQVADTQ
RKMALQRQAAAGLMPLHPQGMMVGAGGPIQQPSQQGNLPPQVQLQQQRMGPAHQNLQQHQ
WAGQGMPPQQRQAMMNQMSHPAMVAAQNHAALMNMAQQQGASGGIPGGAVAGAGIAGGNI
PQAALQELLRTLRSPSSPLQQQQVLNILRSNPQLMAAFIKQRASKYKGVQGGPGGVLPGS
TGGPVANVMAGGGPQVNVNAAGGSQQGMHMVGQGGANVKMATMAQLQQPMLTGLQQQQVA
GGVRGVQGQGSQMGNLNNPQFRDLLMGVNHVQIQQPQPTQGQGYMAQPGMQPPSVGQGPP
GGLPPGPLQQRLQHHLQMQQQNAMAGLGPQPTQSGPQPQSSQALLHQALHQRLGSPAPHS
NPMSPQQMAQSPHLQGQALSASLANQVRSPQPSPRPQSQPPHSSPSPRMQPQPSPHHISP
QMQTGSPHPTTTQQQQNSMEQFGSDPSAMLSQLSGMAGLHGPGGNGQDPLGQNMNHNPLN
IMLSDSSHKLH
Download sequence
Identical sequences G3NY16
69293.ENSGACP00000010236 ENSGACP00000010236 ENSGACP00000010236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]