SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010268 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010268
Domain Number 1 Region: 614-690
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 8.77e-27
Family AN1-like Zinc finger 0.0000256
Further Details:      
 
Domain Number 2 Region: 8-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.12e-23
Family Ubiquitin-related 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010268   Gene: ENSGACG00000007740   Transcript: ENSGACT00000010290
Sequence length 695
Comment pep:known_by_projection group:BROADS1:groupVI:9089550:9100713:1 gene:ENSGACG00000007740 transcript:ENSGACT00000010290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDRKKPPFCNDDSAGALHHKLPFYDTMELFIETLTGTCFELRVLPFEAVISVKAKIQRL
EGIPVAQQHLIWNNLELEDENCLHDYGIAEGCTLKLVLAMRGGPINTRRVTIDDPIKEVT
DLMEGTKEEGWEKSLANKQVTFVVYRENDQLNFFRVVDRGDGTLTPLSESMSGGSVCNVY
AEEEEEEEDGESSAATQQSLENSITMNKMKLLKAKMEDMNLSKKPKKSAKVKPRPSVNPH
PCVGSLGATSSTRHHHRLFRSLSQMNQPWPSNAQLPPIADHESVDPFSLSAAATSAHFSA
SRLREEEPWETCPSFAKIRPPPKVSRLDIGCTRLMRDCVYPQLPPLCIRGPPEASFDPAE
PAGEADGPSLLEEAAGLMAPVQPGTPFGELLDPLSLDVSAQPESRSLGVGAQQQFPISAS
PLGTWTLGTSDALTSDGSHLGTPFYMRSPSPPTSTGPLPLAFDSTLSCLQPDLQAQVKPG
GASNHPPATASTHPLGTRGVKVESPGKRPGLISKREARGIAQMANQAWKEPVGSLKHSDL
LASHSTCRSSTNIRRAAGLHTRALVYVDHSNAFTAKSESSLLQQPTSSTLEGIISHISHF
PIISQRFPDSDCAPTYHLPPVKAPTGSKKKSSKHCFLCGKKTGLATSYECRCGHNFCCSH
RYAETHDCTFDYKGAGRRLLQETNPLISAPKLPKI
Download sequence
Identical sequences G3NY48
ENSGACP00000010268 69293.ENSGACP00000010268 ENSGACP00000010268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]