SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010275 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010275
Domain Number 1 Region: 955-1131
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.46e-47
Family BCR-homology GTPase activation domain (BH-domain) 0.00027
Further Details:      
 
Domain Number 2 Region: 526-643
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 6.02e-36
Family Pyk2-associated protein beta ARF-GAP domain 0.0017
Further Details:      
 
Domain Number 3 Region: 322-416
Classification Level Classification E-value
Superfamily PH domain-like 6.7e-21
Family Pleckstrin-homology domain (PH domain) 0.00031
Further Details:      
 
Domain Number 4 Region: 723-837
Classification Level Classification E-value
Superfamily PH domain-like 4.66e-19
Family Pleckstrin-homology domain (PH domain) 0.0051
Further Details:      
 
Domain Number 5 Region: 7-66
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000216
Family SAM (sterile alpha motif) domain 0.0025
Further Details:      
 
Domain Number 6 Region: 427-542
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000931
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 
Domain Number 7 Region: 1266-1384
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000143
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 8 Region: 853-980
Classification Level Classification E-value
Superfamily PH domain-like 0.000000195
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000010275
Domain Number - Region: 1176-1254
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00413
Family Ras-binding domain, RBD 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010275   Gene: ENSGACG00000007728   Transcript: ENSGACT00000010297
Sequence length 1444
Comment pep:known_by_projection group:BROADS1:groupI:6123882:6150613:-1 gene:ENSGACG00000007728 transcript:ENSGACT00000010297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHSEPRATVSDWLCVLRLEQYSEAFRTAGLATFRQCRNLTPDQLERMGITLPGHRRRIL
ASLTKTNDRALGAERATPVPKERTLFRCSVAVDCDLSPALSPPSGASLPPVPPRSIPNCP
PQRFTSPLCPSPPSRTPASPKPDKRAVEALHLPDFPSAQTRPQTLAIQPPAHHLGGNGDG
LTLSVSPTASLSDDINAPPLPPKAGAAPKGPPPIPHRRRVPCFDDPVRADIPVCCSGSRG
EANYSIQLAPPPPSQHSSSEKKAAERHERRDGRGVKERKQETQEDAQNEPSAGIFQSPKT
SIDLSCAPLSPAPLPPRGSRSPLAAVVKMGWLDKNPPQGALYYQRRWVKLDVDYLRYFDN
EKEVYSKGIISTAFVTHVTSVGELKFEVVTNNRTFIFRAESEVERNDWVTVLQDCTRGRH
HRSTMNPGSPLSPEFQGYLELRGLRSKLYTVVASEKVFLYKNIEDYRLGVGITSIDMNVG
NVKDTDRRGFDLTTPYRIFSFIAESEQLREQWVEAMRNAIGEALSNSEVAERIWAEPSNS
LCADCEAPQPEWAAINLCVVVCKRCAGEHRGLGPSISKVRSLKMDRKIWTEELIQVFLLL
GNERVNSFWAANVPPSEALSPTSCSEERRRFITNKYRQGKYRKYHPLYGNQRELNNALCI
NVQCSDVLETLSLIFCGADVNCSTDMASWPSVLSLASAHSQPLQAELISHNLNTELPRSE
VNEGMAAIHYSTPPCVSHNGFLYKTASMARPITERKSKDEFSRRWCTVNDGTFSYYESDK
NSNPNGALKASDIVCLAVDVPQRHGYDNTFELYSESERLYLFGTDDPDSHKEWVKSIAKT
FIPAGVEPLLKLPFDRIGRLKCKDGLNLQTSKVGWFALVGSTLHAYLEDNKGEEIHLRKL
NELSIQQDNEVLVLVERGRTLYIEGERKLDFSGWCAAIQAAAGSGGDTLSQQQLTETDIP
VIVHSCIGYITQCGLTSEGIYRKSGVNSRVAQLLERFRCDARSVRLREGEHQVDDVSNAL
KRFFRELGEGLFTSKDASSWLSAAAIQDESKKISQYQQLLNRLPCVNKATLQALINHLYC
VQRFSELNQMNVHNLAIVFGPTLFQCDGKDFTAGCAIEDLVQHYTFIFEVDEQQLKKQLD
EITAIIEMREKLNTKFPSTEPGGHFICTVYLEEKKDTAEQHVKIPGSMTAAELACEVLDR
RKIRVKDKDYWNCWEVSDKEEMERPLHYQERVLPILHSFGTDSHLLIKKHLAMEAMMVYL
GSKVDPSKHGMMKFREERSILGLGNFHDRYFILNSNSLRMYKEVRSHYPSVFLCLPQSNR
AERDWQVKNLKVYMGIKKKVRPPTCWGLTVVYESRKQDKQERQQWYLCCDSLSDMREWYA
TFLSIQYDGDVWPQDGLQQTRASRALPETRHGNVSLIPLRGSENEMRNSVAAFSQDALAV
SEPT
Download sequence
Identical sequences G3NY55
ENSGACP00000010275 ENSGACP00000010275 69293.ENSGACP00000010275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]