SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010320 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010320
Domain Number 1 Region: 233-375
Classification Level Classification E-value
Superfamily PH domain-like 5.84e-38
Family Third domain of FERM 0.00075
Further Details:      
 
Domain Number 2 Region: 131-235
Classification Level Classification E-value
Superfamily Second domain of FERM 5.63e-34
Family Second domain of FERM 0.0000807
Further Details:      
 
Domain Number 3 Region: 46-128
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.24e-24
Family First domain of FERM 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010320   Gene: ENSGACG00000007774   Transcript: ENSGACT00000010342
Sequence length 762
Comment pep:known_by_projection group:BROADS1:groupXVI:15327512:15347896:-1 gene:ENSGACG00000007774 transcript:ENSGACT00000010342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PHSPIMLSFLRRTLGRRSIRKHAEKSRLREAQRATTHIPAAGDAKSVITCRVSLLDGTDV
SVDLPKKAKGEELFDQIMYHLDIVEKDYFGLRFMDSAQVPHWLDVTKSIKKQVKIGPPYC
LHLRVKFYSSEPNNLHEELTRYLFVLQLKQDILSGKLECPFDTAVELAAFSLQAELGDCD
PLEHNLDLVSEFRFTPNQTEDVELEIYNKWKECRGQMPAQAEINYLNKAKWLEMYGVDMH
MVKARDGNEYSLGLTPTGVLVFEGETKIGLFFWPKITCLDFKKSRLTLVVVEDDDQGKEQ
EHTFVFRMDHPKACKHLWKCAVEHHAFFRLRGPVQKNSASSGFIRMGSRFRYSGKTEYQT
TKANKARRSASFERRPSRRYSRRTMQNRALLKDPEKLRSCNLTFLILFSTSEQSARRSAW
SSAPVVAPVAASSCAPMEIEALPRSPGGEKRRRRALTTSSGLLSSPLRPLQTRPDRATPT
DPPAPPGKTLSASPVRPQTACNPTEWAIKPPNGNLYSETRKAAARLKQLELESSPLLATP
KNVNVNMAMNNQEDVVKLTEKCGLSSAGSSPVVPPLCTPEDLKSNILKAQVEAAALKEHV
VIVGDKNCNLQEASARSNVTHRGMNSWPLCNRNLILINGFCLSVVFVLQVKAEEVDLHNI
LPLSDNLIDFTDAAPVLPPAQQPKPPITPRWIVPSAAPPAAFTNGLLDLDPPAKVNPLLP
ADGGAAVTPVLPHLAHTPNTVSASPAASEDGAKPRGLLTTEL
Download sequence
Identical sequences G3NYA0
ENSGACP00000010320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]