SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010327 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010327
Domain Number 1 Region: 228-377
Classification Level Classification E-value
Superfamily PH domain-like 3.38e-37
Family Third domain of FERM 0.00085
Further Details:      
 
Domain Number 2 Region: 126-230
Classification Level Classification E-value
Superfamily Second domain of FERM 5.89e-34
Family Second domain of FERM 0.0000807
Further Details:      
 
Domain Number 3 Region: 41-123
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.24e-24
Family First domain of FERM 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010327   Gene: ENSGACG00000007774   Transcript: ENSGACT00000010349
Sequence length 782
Comment pep:known_by_projection group:BROADS1:groupXVI:15327512:15347887:-1 gene:ENSGACG00000007774 transcript:ENSGACT00000010349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSFLRRTLGRRSIRKHAEKSRLREAQRATTHIPAAGDAKSVITCRVSLLDGTDVSVDLP
KKAKGEELFDQIMYHLDIVEKDYFGLRFMDSAQVPHWLDVTKSIKKQVKIGPPYCLHLRV
KFYSSEPNNLHEELTRYLFVLQLKQDILSGKLECPFDTAVELAAFSLQAELGDCDPLEHN
LDLVSEFRFTPNQTEDVELEIYNKWKECRGQMPAQAEINYLNKAKWLEMYGVDMHMVKAR
DGNEYSLGLTPTGVLVFEGETKIGLFFWPKITCLDFKKSRLTLVVVEDDDQVNQSSPQGK
EQEHTFVFRMDHPKACKHLWKCAVEHHAFFRLRGPVQKNSASSGFIRMGSRFRYSGKTEY
QTTKANKARRSASFERRPSRRYSRRTMQNRGEDESLELCTNVIAPGSVRLQAPPGRSAWS
SAPVVAPVAASSCAPMEIEALPRSPGGEKRSLPAVADLMETCIDDVLRAPVVPVETAADE
AGPSYAYGPPSATGEDPLGLAEAAARLKQLELESSPLLATPKNVNVNMAMNNQEDVVKLT
EKCGLSSAGSSPVVPPLCTPEDLKSNILKAQVEAAALKGSLEEHVVIVGDKNCNLQEASA
RLKVRTGRLGSNSSLSISSRPEIQDSWDLLKSASLVCSAGASAERLADDLQPSAATTPCE
SASDGTAPKVKAEEVDLHNILPLSDNLIDFTDAAPVLPPAQQPKPPITPRWIVPSAAPPA
AFTNGLLDLDPPAKVNPLLPADGGAAVTPVLPHLAHTPNTVSASPAASEDGAKPRGLLTT
EL
Download sequence
Identical sequences G3NYA7
ENSGACP00000010327 ENSGACP00000010327 69293.ENSGACP00000010327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]