SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010344 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010344
Domain Number 1 Region: 628-909
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.13e-75
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000184
Further Details:      
 
Domain Number 2 Region: 215-361
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-41
Family Third domain of FERM 0.0000896
Further Details:      
 
Domain Number 3 Region: 113-217
Classification Level Classification E-value
Superfamily Second domain of FERM 2.49e-34
Family Second domain of FERM 0.0000869
Further Details:      
 
Domain Number 4 Region: 27-111
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.27e-21
Family First domain of FERM 0.0015
Further Details:      
 
Domain Number 5 Region: 518-610
Classification Level Classification E-value
Superfamily PDZ domain-like 1.46e-19
Family PDZ domain 0.0000241
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010344   Gene: ENSGACG00000007798   Transcript: ENSGACT00000010366
Sequence length 924
Comment pep:known_by_projection group:BROADS1:groupXVI:15352226:15376717:-1 gene:ENSGACG00000007798 transcript:ENSGACT00000010366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSARFHLPAGRSYNVRATELERDRQHTQVVCSVLLLDNTFQAFKVCKSDPGQVLLDAVFK
HLELTERDYFGLHLADDSLDSPRWLDPNKPVRKQLKRGSPYSLSFRVKFFVTDPGKLQEE
YTRYQYYLQIKQDIVTGRLPCPHNTAALLASYSVQSELGDYSETEHAAGYLSEFCFMPSP
PHDFHKEVAKHHQQHSGLSPAQSEFNYLNTARTLELYGVELHYARDQSNTEILLGVMSAG
IVIYKNRVRINYFPWLKIVKISFKCKQFFIQLRREATETRETLLGFNMVNYRACKNLWKA
CVEHHTFFRLDRPIPPQKNFFAHYFTLGSKFRYCGRTEVQSVQYGKDKGIKDRVFARSPS
KPLARKLVGGTDWESVSRNSLSDERLETQSLPTRSPPGTPTQNSLFVQEGTRLRPSSVGH
LVDHVIHASPSLPVFSSSNHRSASSTQANSISLDSPPMSPEGLDGQPPALPPKQLSRKTL
SQIIQAHSQQSLLDNHLNEMYDVPVNADKTTLNGVVPHDNLVLIKMRPDEHGRFGFNVKG
GADQKMPIIVSRVAPGTSADLCVPRLNEGDQVVLINGRDISDHTHDQVVMFIKASCESHS
GELILLVRPNAIYDVVEEKVDSEPDFQYIPEKCPQDPAQLDQHALRDSMVTLKEGLSSGA
ILAQFDQLYRKRPGMTMLCAKLPQNVSKNRYRDISPYDATRVILKSTDDYINANYINMEI
PASSLINRYIACQGPLPNTCPDFWQMTWEQGSSMVVMLTTQVKCHQYWPNPGSSATYGDF
TVTCHNEEGNTAFLVREMSLTNTQSEQERELTQIQYLAWPDHGVPDDSTDFDFVALVRTK
RAGQNQPLQCGHRAGPGVLITMETALCLMECAQPVYPLDIVRMRDQRAMMIQTPSQYRFV
CEAILKVFEEGLVKPVKTVVYQLR
Download sequence
Identical sequences G3NYC4
ENSGACP00000010344 69293.ENSGACP00000010344 ENSGACP00000010344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]