SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010439 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010439
Domain Number 1 Region: 12-291
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.32e-75
Family BAR domain 0.0011
Further Details:      
 
Domain Number 2 Region: 413-530
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 9.81e-43
Family Pyk2-associated protein beta ARF-GAP domain 0.00013
Further Details:      
 
Domain Number 3 Region: 259-382
Classification Level Classification E-value
Superfamily PH domain-like 2.26e-27
Family Pleckstrin-homology domain (PH domain) 0.0044
Further Details:      
 
Domain Number 4 Region: 682-800
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.97e-26
Family Ankyrin repeat 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010439   Gene: ENSGACG00000007862   Transcript: ENSGACT00000010461
Sequence length 845
Comment pep:known_by_projection group:BROADS1:groupXVII:6859975:6880888:1 gene:ENSGACG00000007862 transcript:ENSGACT00000010461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KREDLINCVALSSLCRAGIDDVETDVVEIEAKLDKLVKLCSGMIEAGRAYVSANKLFVNG
IKDLSQQCKKEEMISECLEKCGESLQEIVNYHMILFDQAQRSIKQQLHTFIKEDVRKFKD
TKKQFDRVREDMELAQVKNAQAPRNKVHEAEEATQALVLSRKAFRHLALDYVLQINVIQA
KKKFEILDAMLSFMRAQCTLFQQGFNILDEIDPYMKKLAAQLDQLVIDSAVEKRELEHKH
ALIQQRTLMQDFSYDDTKLEFNVDAPNGVVMEGYLFKRASNAFKTWNRRWFSIQNSQLVY
QKKLKDSLTVVVEDLRLCSVKPCEDNERRFCFEVVSPTTYRSCMLQAESEKLRQAWIQAV
QASIASAYKDIADNYYIERLDRTASPSTSSIDSASEPRERGERSDKVIRGGVESLLQRVQ
GLPGNELCCDCGQTAPCWASINLGVLLCIECSGIHRSLGVHCSKVRSLTLDSWEPELLKL
MCELGNTVINHIYEGACKELRAKKPRPSSSRQEKEAWIKAKYVEKRFLTKMSGSEALVEG
ERKFRPWTVKKCHRHNSSVRAPNKARMRYHRYEPGSASPANLSAGQCRQLTKFRRDSLFC
PDELDSLFSYFDTGSGPRSLSSDSGLGGSTDGSTDILVFGSVVDSVTEEDEESEESSSGE
VEIEQEVSSDPEDQRELHPGALLHRSARLHNLPLMAEALAHGADIHAANEEEGKTPLIQA
VAGGSLIACEFLLQNGADVNQRDMRGRGPLHHATYLGHTGQVCLFLKRGASQTEVDEQGH
DPLSIAVQAANADIVTLLRLARMNEEMREAEAPLGQPGPYHSSSPTEQQYRKCIQEFICL
TIDEC
Download sequence
Identical sequences G3NYL8
ENSGACP00000010439 ENSGACP00000010439 69293.ENSGACP00000010439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]