SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010451 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010451
Domain Number 1 Region: 187-329
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-37
Family Third domain of FERM 0.00000653
Further Details:      
 
Domain Number 2 Region: 83-188
Classification Level Classification E-value
Superfamily Second domain of FERM 1.11e-30
Family Second domain of FERM 0.00000288
Further Details:      
 
Domain Number 3 Region: 2-82
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.27e-23
Family First domain of FERM 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010451   Gene: ENSGACG00000007879   Transcript: ENSGACT00000010473
Sequence length 1463
Comment pep:known_by_projection group:BROADS1:groupXX:9233627:9246960:1 gene:ENSGACG00000007879 transcript:ENSGACT00000010473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMQCKVTLLDDTQFECELDKHAKVQELLTKVCDHVNLLERDYFGLVTLETPESKTWLEST
KEIRKQVSGGLYEFAFGVKFYPPDPAQLTEDLTRYFLCLQLRKDIIHGVLPCSFVTLSLL
GSYTAQSELGEYDPELHGTDYVKDLSLAPGQNKELEEKVMELHRTYRSMNPAQADLLFLE
NAKKLSMYGVDLHQAKDLDGIDITLGVCSGGLMVYKDKLRINRFPWPKVLKISYKRSSFF
IKIRPSEQEQYESTIGFKLPNYKASKKLWKVCVEHHTFFRVPTVEPPSSRRFLVLGSKFR
YSGRTQAQTRQASSLIDRPAPRFTRSASKRLSRNLELLRQLSASTRSEQDDWFLYFDQTF
SLSSLERVDRPLSRLTQLQLRLEDEQAMQKQTSEESFERLQESLILVDKLREMDDLKRRL
REVKDLEDRLTDMDEMAEHLQGAIEEELGREEAEKLIREENDVEQEEQIQVRGITVSKKS
FSTTETKEEEVDELEEEEGAEIKREMEIEVASESLSDDTLRGKLHQIKKEWQEKVEEKLK
SGFSDVTSTTSVVAYQVVEGRTGKRVPIVDEGALTQAEVEDVQRGVALEETVEEEATWIK
TETPQAITEGEVTERLQAEDRSPAADKDIWFILFELPPYKAVFKPPGTVSEISTFEERTE
TVEETTVRGGVWRVPEIPPPQTIMERDDDWFVWLDVVARETSYVPPGTAQTLPLLLVGVQ
EEMPKRPPPDRDDDWFVLLDVTPRESSYKPPVSVALKRSDQMGAESFVAVAATATQEDIE
EVVSEEKMMMDAEPRRPLALRQPVLDRDDDWFVLLDAVPRETPYVPPVAAADRVEVSPEG
LVSVIPLTVGQEGEDGVGIEAADAELEGALIEARVVALPVGVRERDDVWFVLLDVPERTP
TYVPPVTVAEYVEVAPEESISTAAETMTVESRKEVIVEELVVYKEDGGLQEVSQPVRERD
DDDWFLLLDVVPREAPCVPPGTHRLQGPFIGFHTHYHTKEDYLTNSRDVTQTISVEPQPM
EAITTEQKLQRVDAEQIRLEPSRPEREDDWFVLFDTIRQKAVAIPSGARSPLAAVDERLR
AHTEVRTAEEFSANKQRARQAVAVVEETWRREAAVQQRPQAAVREVEDDWFILMNVATKK
SEHCVFVLVVPERIQFLAEVSVPTAQAASTIARPERRAHFEKRILEERRPLAQTHVNDDW
FVLLDVAPKESGTVRPSGFCRFADEQLAHMAALSSPRGTLRYVCRPSAGSADSSSKNKNK
KKRIHKAHEGTVFPRSVRTYLISSRLDTDAFGPVVSTQRGARPVSAPVFSQAALAEAGIP
MAPLDQPQTSTPIKTSRKEERKLEVTVEAVEPSKTEAVAEKRAKRIEGDSIYIRHSLLML
EEFDKPQEDLLRHHASISELKRNFMEAATETRPSEWDKRLSTHSPFRTLGINGQPLPSAD
GPWSHFHEAFQITSAAFAQLSLL
Download sequence
Identical sequences G3NYN0
ENSGACP00000010451 ENSGACP00000010451 69293.ENSGACP00000010451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]