SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010464 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010464
Domain Number 1 Region: 455-524
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.82e-19
Family PHD domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010464   Gene: ENSGACG00000007895   Transcript: ENSGACT00000010486
Sequence length 604
Comment pep:known_by_projection group:BROADS1:groupXIX:8989169:8999518:-1 gene:ENSGACG00000007895 transcript:ENSGACT00000010486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELQMLQEALKVEIQIHQQKLVAQMKQDPQNADLKKQLHELQAKITALSEKQQKKVVEQL
RKELLVKQEPDAKLQLHVQTPPAGGDMKPGNLLQSQQIPGGLQQNSWHYPRLRVPVMKMR
ICLQTLAVTPVLTAKTIPLVLKAAAAPPGSVLPHRPPAVAMVTTAIPKPDLQNAPINLQV
VSKLTNQSSEPVRLVSKNAMVTVTSSCAQPIKVPQFVPPPRLMPRPTFQPQVRPKPATPT
NVHIAPAPPPPMMAAPQLLQRPVMLATKLSSSLPSAPPIHQVRIVNGQPCGKAGAAPLTG
IVITTPVTASPARLASPAQVLGLTPILTPTPAKPIQISSLIAEPKVGDPPPPPRTKKEEN
PEKLAFMVSLGLVTHDHLEEIQSKRQERKRRTTANPVYSGAVFEPERKKSAVSYLNSPLH
QGTRKRGRPPKYSSVPELGCLTPTSPSSPVRPLPLPSPSSGDGDIHEDFCTVCRRSGQLL
MCDTCSRVYHLDCLDPPLKTIPKGMWICPKCQDQILKKEEAIPWPGTLAIVHSYIAYKEA
KEEEKQKLMKWSAELKLEREQLEQRVKQLSNSITKCMETKNSILARQKDMHLSLEKVKHL
IRLI
Download sequence
Identical sequences G3NYP3
69293.ENSGACP00000010464 ENSGACP00000010464 ENSGACP00000010464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]