SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010495 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010495
Domain Number 1 Region: 359-722
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 2.22e-124
Family Hect, E3 ligase catalytic domain 0.00000000618
Further Details:      
 
Domain Number 2 Region: 13-138
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.18e-21
Family PLC-like (P variant) 0.059
Further Details:      
 
Domain Number 3 Region: 265-305
Classification Level Classification E-value
Superfamily WW domain 0.00000000000362
Family WW domain 0.00097
Further Details:      
 
Domain Number 4 Region: 221-259
Classification Level Classification E-value
Superfamily WW domain 0.0000000011
Family WW domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010495   Gene: ENSGACG00000007912   Transcript: ENSGACT00000010517
Sequence length 729
Comment pep:known_by_projection group:BROADS1:groupXI:4921068:4932953:-1 gene:ENSGACG00000007912 transcript:ENSGACT00000010517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNPGTRRNGSSIKIRLTVLCAKNLAKKDFFRLPDPFAKVVVDGSGQCHSTDTVKSTLDP
KWNQHYDLYIGKTDSITISIWNHKKIHKRQGAGFLGCIRLLSNAISRLKDTGYQRLDLCK
LNPSDSDAVRGQIVVSLQTRDRIGSGGPVVDCRGLLENDGPVFEGCFSEEPLPYSDPTGA
AGGGNCRLDSPGQEGSLQTQRIRGQDSRGHGHTPQNRPHGHQPLDLPEGYEQRTTVQGQV
YFLHTQTGVSTWHDPRIPRDLASVSCEELGPLPVGWEVRSTVSGRIYFVDHNNRTTQFTD
PRLHTIISQQSQAKESSQAPLMDVGGEEGVGGGVGGGGEGDVAARYERDLVHKLKLLRHE
LSLQQPQAGHCRIEVSREEIFEESYRQIMKMRPKDLKKRLMVKFRGEEGLDYGGVAREWL
YLLCHEMLNPYYGLFQYSTDNIYTLQINPDSSINPDHLSYFHFVGRVMGLAVFHGHYING
SFTLPFYKQLLGKPIQLNDLETTDPELHKSLVWILENDITSVLDHTFCVEHNAFGKFSQH
ELKPNGRNLPVTEENKKEYVRLYVNWRFMRGIEAQFLALQKGFSELIPQHLLKPFDHKEL
ELIIGGLGKIDLADWKTNTRLKHCTSESNVVRWFWQAVEAFSEERRGRLLQFVTGSTRVP
LQGFKALQGSTGSAGPRLFTIHLIDANTDNLPKAHTCFNRIDVPPYESYEKLYEKLLTAV
EETCGFAVE
Download sequence
Identical sequences G3NYS4
ENSGACP00000010495 ENSGACP00000010495 69293.ENSGACP00000010495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]