SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010526 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010526
Domain Number 1 Region: 502-667
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.02e-44
Family Ypt/Rab-GAP domain of gyp1p 0.011
Further Details:      
 
Domain Number 2 Region: 642-766
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.68e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0071
Further Details:      
 
Domain Number 3 Region: 111-244
Classification Level Classification E-value
Superfamily PH domain-like 3.57e-21
Family Phosphotyrosine-binding domain (PTB) 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010526   Gene: ENSGACG00000007940   Transcript: ENSGACT00000010548
Sequence length 1035
Comment pep:known_by_projection group:BROADS1:groupVIII:9149275:9226883:1 gene:ENSGACG00000007940 transcript:ENSGACT00000010548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDRSSLRKVSSSTESVATVTSEEFVLVQPSAAGSPQGSEGKPRLKMSLNGSEQLEKAME
EVFDDDKEVKVEKSNVEKMEKIFTETHFSGKQTKSQVLRLSTDACPAPSSSTVLEEDSVQ
FNKLSYLGCTWVKAPRNEAEAQRAMATLRAESAIPIPVTLHVPCGPDGSVRIADEASGTE
IASFPIYKVLFCARGREGSVESDCFSFTESYRSSEDFQIHVFSCHIIEAVSRILYSFSTA
FRRSSRPVDTRDTALSSLPDGDLYTFTVSLEVKEDDGKGNYSPVPKDRDKLYFKLRQGVQ
KKVVVSVQQMCNKELGIERCFGMLLSPGQKVCNSGMHLLDMTSMGKSSDGKAYVITGTWN
PNMAAFQLLNEDTPKDKQVYMTVAVDLVVTEVVEPVRFLLETLVRVYPSNERFWYFSRKT
FSETFYLKLRQTPERLGQSDAVYEVVSLQREAERSNEGRLAPPTEEEEADEDSDSEISSG
TGDVSKDCPEKILESWGGLLTRWHGNLSTRPKGLPSLVRSGIPEPLRAEVWQLLAGCHDN
YDLLEHYRILITKDSAQEGVITRDIHRTFPAHDYFKDSDGDGQDSLYKICKAYSVYDEEI
GYCQGQSFLAAVLLLHMPEEQAFCVLVKIMYYYRLRDLYKNNFEDLHCKFYQLERLMQDQ
LPDLWSHFHELNLEAHMYASQWFLTLFTAKFPLCMVFHITDLLLCEGLSIIFNVALALLK
TSKEDLLQADFEGALKFFRVQLPKRYRAAENARRLMEQACNIKVPTKKLKKFEKEYQTLR
ESQLQQEDPIDRFQRENRRLQEASMRLEQENDDLAHELVTSKIALRNDLDQAEDKTDVLN
KELLSTKQRLVETEEEKRRQEEETAQLKEVFRRELEKAELEIKKTTAIITEYKQICSQLS
TRLEKQQAATKEELDFVRSKVMGCDNCRDLFTTLGSLQASSPGRDKTYGEPSDEEKDGLK
EQLRHLELELAQTKLQLVEAKCRIQELEHQRGVLMNEVQAAKNSWFSKTLGSLKSSTSSS
SSSTSQTPSSPKEGP
Download sequence
Identical sequences G3NYV5
ENSGACP00000010526 ENSGACP00000010526 69293.ENSGACP00000010526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]