SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010595 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010595
Domain Number 1 Region: 1232-1374
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-50
Family Phosphotyrosine-binding domain (PTB) 0.00000139
Further Details:      
 
Domain Number 2 Region: 268-395
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.54e-36
Family PLC-like (P variant) 0.0024
Further Details:      
 
Domain Number 3 Region: 100-266
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.84e-30
Family Dual specificity phosphatase-like 0.00022
Further Details:      
 
Domain Number 4 Region: 1099-1229
Classification Level Classification E-value
Superfamily SH2 domain 2.96e-22
Family SH2 domain 0.0021
Further Details:      
 
Domain Number 5 Region: 1-43
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000493
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010595   Gene: ENSGACG00000007995   Transcript: ENSGACT00000010617
Sequence length 1377
Comment pep:known_by_projection group:BROADS1:groupXVII:7084240:7102597:-1 gene:ENSGACG00000007995 transcript:ENSGACT00000010617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HTFTEKSFKRKRACDVCKQNIDNPGAFCKECKVAVHKMCKAKKIVLPCQRFRLMDVREKT
HRTQISQHGSTKSTQQNKRGSIPRSKSMEKAMEDVMERHYDFDLTYITERIISVFFLPDL
EEQHYRRNLQEVASMLKSKHQDTFLLLNLSEKRHDITRLNPKVQDYGWPDVHAPPLDRIC
AVCKAMETWLTSDPNNVVVLHCKGNKGKTGVIVAAYMHYSKISAGADQALTTLAMRKFCE
DKVSSSLQPSQNRYIYYFGGLLSGTIKMNSSALFLHQVLIPSLPNFQAGGGFYPFLKIYQ
SLQLVYTSGVYDPQSSRARKLCVTVEPALLLKGDIMVKCYHRRSQAAEREVVFRVQFHTC
TVHGAQLWFGKTELDLACTDDRFPPDATVEFIFSNGPDKIKGREYRENDASIKVDYNISE
PVIRWDSYENFNLHHQDSIETDISHTRGPLDGSLYAQVRKRRGPGSTASAASPNGCLTSS
PTVKPQTPSHFSVPSDHLEQPSLTIMRPDGENTDRPSRSGGLRQEHSCCGQAGAKFGNGG
RGREQEPLPTKSVSPPPPSTHMEICHRHSVHPLQQLPWERPAPLPPLPCLLRPCFPYSTP
DHTHHNSHTLPALNRLCTGEECHLLRYSNHNPASHLSHQSLPSSPYREMFFSSQTQSSGC
PCRDCTGRREHQSASVRAFHPLHPDETENPQWSQGVGMQRTREAPTLWESENPWEGVREA
EFWQCKSAEPAFHVCHSTLNQSPNMEPRYAIGPHQGYPCPQLLMDVRDGASSGYHTPPQP
RHSCPCSPYQSSPAASHESRGYASGYHSGSTSPLPASSPSPVRGRLPDTPCESGDQQHSE
HHKAEQAKADVEDDMSQGSEGRSDSNGQSSTPGQDSDHDYTIIGSSSPTHTEDSAERSQQ
SRTSSYTTVTIPPVQVQLNGSALPSDTLSDSSRGTSMKPSVCLSSSPSTTSPNSPIGSLD
LQSSLQCSTSATDGAGESLTLERDCSNDTKPPSPVPDGYQTPTFPLASNYYPLLNVPHVP
YTGYTAITIPAVQPPLPEKKRLSSTPGYLNGHHSLLRVSSAPSPTHHVSFCPSAGEQRRG
SSHHNCREEADIRVNAKFVQDSSKYWYRPGISRDQAIAVLKDKGPGTFLIRDSNSFQGAY
GLALKVATPPPNANITVSKGDPLEQLVRHFLIETGPRGVKIKGCQNESYFGSLSALVYQH
SITPISLPCALRVPEKDLVGELQEMQSATNTSTAADLLKQGAACNVLYLNSLETESLTGP
EAILKATKCTLALIPRPAATVVHFKVSSQGITLTDSKRRLFFRRHYPINSVTFSSLNPQD
QRWTNSDSTSSKMFGFVARRTGSSTENVCHLFAEMDPEQPAVAIVNFINKVMLGPQL
Download sequence
Identical sequences G3NZ24
ENSGACP00000010595 69293.ENSGACP00000010595 ENSGACP00000010595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]