SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010631 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010631
Domain Number 1 Region: 26-232,333-586
Classification Level Classification E-value
Superfamily Ras GEF 2.88e-101
Family Ras GEF 0.00029
Further Details:      
 
Domain Number 2 Region: 243-342
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.96e-25
Family Ras-binding domain, RBD 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010631   Gene: ENSGACG00000008032   Transcript: ENSGACT00000010653
Sequence length 587
Comment pep:known_by_projection group:BROADS1:groupXX:9390779:9402005:1 gene:ENSGACG00000008032 transcript:ENSGACT00000010653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSASRLPHSSSADSSSDSTSRAEPVTMPTFDVPYFRYIDDEGTEGDEGWSSSRSMSSIEE
DSSTDSVVSDRYMVVSGTPEKILEYLLDDLTLDDDQGTTPTKESDILVDDFLLTYPVFMS
TGDLCQALLGQYPCKRYRGKEDRKEALERKRKVLHLVSQWMSLCRGFLREDEHVKLFTKT
LYRYVLDDLYEHPFLEKDVRELQKLYQLHRRQAVDEYSPQRKGKALFHQLSLKENSLQSR
GTQGETKAALCHVYVTMDSFLSMRAHAGMVAEELLQAVAERMEVPLEKLVLLAVTYNGGR
HLLQPQDRVFSDSLRPVGRLHVCRKDLGEVLNPFTDNSELQQRTARMLSINTWDVAVALT
DFDWTIFESIHEQELVYFTFSRHSSSSHTVALELLLQRCNEVQLWVMTEVLLCSALCKRV
QLIKKFIKIAAHCKAQRNLNCFFAIIMGLNTAAVSRLGQTWEKIPGKFKRLFAELETITD
PSLNHKAYRDSFKKMKAPKIPFPPLLLKDITFIHEGNKTFHDNMVNFEKLHMIADTLRLI
RQCQKDHMGNGITQKSSSEVRAYIDYLHIIDNQQTLFELSHGLEPRA
Download sequence
Identical sequences G3NZ59
ENSGACP00000010631 69293.ENSGACP00000010631 ENSGACP00000010631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]