SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010640 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010640
Domain Number 1 Region: 2-78
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.14e-35
Family Ubiquitin-related 0.0000204
Further Details:      
 
Domain Number 2 Region: 78-130
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 7.32e-19
Family Ribosomal protein L40e 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010640   Gene: ENSGACG00000008021   Transcript: ENSGACT00000010662
Sequence length 130
Comment pep:known_by_projection group:BROADS1:groupVIII:9278187:9279904:1 gene:ENSGACG00000008021 transcript:ENSGACT00000010662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ANMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD
YNIQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLHPRAVNCRKKKCGHT
NNLRPKKKLK
Download sequence
Identical sequences G3NZ68
69293.ENSGACP00000010640 ENSGACP00000010640 ENSGACP00000010640 ENSPFOP00000001094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]