SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010646 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010646
Domain Number 1 Region: 1-82
Classification Level Classification E-value
Superfamily PH domain-like 3.13e-23
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000734
Further Details:      
 
Domain Number 2 Region: 143-266
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0000314
Family HBL-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010646   Gene: ENSGACG00000008041   Transcript: ENSGACT00000010668
Sequence length 305
Comment pep:known_by_projection group:BROADS1:groupVIII:9282717:9296560:-1 gene:ENSGACG00000008041 transcript:ENSGACT00000010668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QAIINSTITPNMTFTKTSQKFGQWADSRANTVYGLGFSTEQQLQQFAEQFKEVKEAARLA
REKSQERFELANPALDIAAPELVQQLSEERHSPPLLTVNGPGEEKLFRSRSAEVELTAEK
ERVKKMLSEGSMCEINLEAELFTLQDSNSKLVEALQEANSSVDQWKKQLAEYQEETDRLR
DQVAELEAQLGHPAAGQTEELSRSLEELEALLSAKDQEIHNLQSKKTDVRELEKEREAAM
QRLQDLEKQNADLEERVQSAEKTLESSREEQSHSEVEVRRVIDVLDVKIGDLSDLRQSLA
KLIDK
Download sequence
Identical sequences G3NZ74
ENSGACP00000010646 69293.ENSGACP00000010646 ENSGACP00000010646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]