SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010649 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010649
Domain Number 1 Region: 870-989
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.17e-26
Family Ankyrin repeat 0.000000304
Further Details:      
 
Domain Number 2 Region: 4-85
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.13e-24
Family Ras-binding domain, RBD 0.01
Further Details:      
 
Domain Number 3 Region: 1000-1060
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000144
Family SH3-domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010649   Gene: ENSGACG00000008040   Transcript: ENSGACT00000010671
Sequence length 1069
Comment pep:known_by_projection group:BROADS1:groupVI:9389657:9404610:-1 gene:ENSGACG00000008040 transcript:ENSGACT00000010671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPQMFLTVYLSNNDQHFTEVPVTPETLCRDVVDLCKEPGEADCHLSEMWRGSERPVGDGE
RMLDVLQRWGQHRAEVRFFLRHNRAPGRESGGSRASEQKRNGVKGPPERRMENGVATPRM
DMTLAELQDMAARQQQQIETQQQLLASKEQRLRYLASEQEKLQRLRENIENQETRLKKVR
ALKGQVEQKRLSNGKLVEEIEQMNNLFQQKQRELVMAASKVEELGRQLELLKTGKMENFH
DNQSSVAELDRLYKELQLRNKLNQDQNSKLQQQREGLNKRNMEVAAMDKRISELRDRLWK
KKAALQQKENLPVPSDGQAGPQSGPSRVAAVGPYIQSSTMPRGPVRHDLLVKPAHPDGTA
TLPATEPQSKAGTGGPAGLQPSKLADWASPGPESNGHAPSSTLPRMTSHSNSNAEQDETE
PKRDRKVRPFSMFEPTEVPAASLRKNQSSDDLVRDAQAAPKAPVKVPPPVPTKPKGPGIV
PYGKPGLNTGTFPKTKPQSQQPQAPQGRGPLPPSQSQTLPLPSKQDTPPAATVRPFTPEL
PSSKDASMSKPQTVAASSIYSMYTQQAGSAKPFHQPGLQGTLNRSQSRTNGFVSVYGKPV
IPGGGAVHPENPYMDRRSPGFESEVDNSVPNNVGPGPSEGPQTETERIPRPLSPTKLLPF
ISNPYRHQSDGDLEALRKKLYNAPRPLKKRSSITEPEGPAGPNIQKLLYQKTTLAAMETV
TTPTTSPYAGEAETATEGSSRQHVPSQPKPASAIRESEDIIPPPPPSHPAPRPDDALFPP
PPLAGLEDAMAILPPPPPESFLEEFPPYPPPPYPSGAEQESLGEDTFNMKAPEVTGQVTL
PPGKRTNLRKLGSERIDHSMRVKFNPLALLLDSSLEGEFDLVQRIIYEVEDPSLPNDEGI
TALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWTPLHCAASCNNVQVCKFLVESGAAVFA
MTYSDMQTAADKCEEMEEGYTQCSQFLYEGVQEKMGIMNRGVVYGLWDYNGVNPDELVFR
EGDCMTIVRREDEDEIEWWWARMGDTEGYIPRNLLGLYPRIKPRQRTLA
Download sequence
Identical sequences G3NZ77
ENSGACP00000010649 69293.ENSGACP00000010649 ENSGACP00000010649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]