SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010677 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010677
Domain Number 1 Region: 23-109
Classification Level Classification E-value
Superfamily UBA-like 3.83e-27
Family UBA domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010677   Gene: ENSGACG00000008043   Transcript: ENSGACT00000010699
Sequence length 1137
Comment pep:known_by_projection group:BROADS1:groupXIII:8149971:8161261:-1 gene:ENSGACG00000008043 transcript:ENSGACT00000010699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMTSVVSNQARGTRDGTASTTTQTTQPQKAKQQATAEQIRLAQVIYDKNDTDFEDKVKQL
IEVTGKAPDECVVALHDCSEDVNKAINFLLESTSDTNSWETVGKKRTLGKEGGPLEIKES
REKKGEREASRARGASNRRGRGISRGREGRLEENGFEVAPGERGGDRGRRGRGRGAGVRG
RGRAAAGNRFSSQGMGIFNPADYSANSRARQDAWEGNDTAEGTGKGCLIVRFKVFPYPFC
RSSILCFLGTWEGNVEDWAAEEWNEDLSETKVFTASSPPANHNTPGSNVDVASGISMDSD
IEAVVDGPSAEHLGQSLVFTNSHHNGRTATHSYAHATANSYAHAASASTHYAHAALSSVL
GSGFGSLNAPKPTPTSDIRTSEQLGPRLGQRANTGGTLIQNPVPAFSPAQEVKARRVEAG
PVTAQHMDMKLQPEPSAVLGQLAQRQQSSILPTTDSLGLSRAPQVPTPPGRAARLSHNAN
QVEMHRYNWLQPPHRQLKTQRRKVPPSSKIPSSAVEMPGSADIPGLNVQFGALDFGSEQP
QSSLFSKPGPVSEHMNSLPMAVSDPSFPSPSLGLPSATPSPSMGLPSAAAPPSSIASRVE
SSGPRSLPAHLGFSQTKDATSAAALTNGYSGMKTQSTQDILLVCNKQKKRTPNYFSFKTA
SRTIKTESPVMTSDAGHHIPSPALTPSHSTSIPSLSSHVTSAHSAGSALATSSSHTMSNV
EHISGNLHAFSSSSSQVVDSSPSAHLAISGSIPNGLHPSGAPGLTPNGTNPQLSAASSRT
APLLTTTSGKAPPNLAQGVPPLLANQYIMGPGGLLPAYPQIYGYEDLQMLQSRLPIDYYG
ITFPGTTAAMPGRESLANNPYSGEATKFGRNDSSSPAPQTSMSAAGVQPQPQQAPQAGTQ
GQGQGQQTQNQAFLNPPLPPGYGYTGLPYYAGVPGVPSAFQYGPTVFVPPASAKQPTMGL
ANPSNQYHQQHQPSYGQHAYGAAFDDLSQAHGGEYSKGGYGGSAQSQAKSAGSGPGKAPG
LSGSGTSGGVSDMGASIYSKTQSFDKQGFHTGTPPPFNLPSALGGGGPLNPGGAPGYAPT
PFLHILPPHQQPHSQLLHHHLAPDGQGGPGQRNQSSSMQQKTQGSKSSYGSSPYWAN
Download sequence
Identical sequences G3NZA5
69293.ENSGACP00000010677 ENSGACP00000010677 ENSGACP00000010677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]