SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010742 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010742
Domain Number 1 Region: 975-1104
Classification Level Classification E-value
Superfamily PH domain-like 1.84e-21
Family Pleckstrin-homology domain (PH domain) 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010742   Gene: ENSGACG00000008118   Transcript: ENSGACT00000010764
Sequence length 1118
Comment pep:known_by_projection group:BROADS1:groupX:12469422:12479286:1 gene:ENSGACG00000008118 transcript:ENSGACT00000010764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPFTEKLLERTRARRENLQKKMAERPNAANRQMVKRPREPLADTNRVISESVLDKGTNT
LVSSKPSPSKRRCSEENLSPPAGAENQEPTTSLAAASRPALQPQPEQLETPEPQEMTPAP
TLPSSREEEMVSSAPQGNKDLAEVRAPPAAGMKSRLQRLAQQRQYWDGDDSHDAVPDCAP
TSPLKKRAEVPPAAVHTVSSGTPVGRRGRLANLAATIGTWEDDLSHANIPKESAKEKPAS
TVPKSAVRDAAVAASTKPARPVLKSVISPQKGSTQERTFPSSPQKGSNQERTFPSSPQKI
SNQERPVPSSPQKISNQERPVPSSPQKSSLQGKAFPSSPQKAGPISSTSVPQSPLKTQAL
VRGPASSPQKPELCGKPAASGPPGVKSFLERFGERCQERTNQGSPAGGASQSKTTVATPS
AVTPNTRMVQDRLQAARTANTTSAELAQRQKLERESELAQIRSRFQKGNNNNMWKNNDKS
AETISNEDIKIHPESAPLQVFHHISSLAVVLSSVTLLIGFLFPAFDVATHTSSPGWMMSP
PASASSPLKAVSRPVEQKSAQPPEEEEVVKETEMNVDESINSAVITELFDRALDHSDDDD
EEEEEDALNISSMSLLTPLAETVAAVVDSPKRQMMSDTPGNVSKPSKFQRTNIKRTGSSE
TLDEDHKLPYSISAYRSTRVKEAERSSVKQVIVRKEDVSRRAEEPTGSSLPSIKQKMKIL
TNELNLQQTVIHQASQALNCCTDEEHGKGSQVEAEAERLLLVATERREALKAELDGLRGD
PKGQKKSSAAAEPSGTSASKGSVTLQELRLPLKADFVCSIANKPESTKHSFFLMIRAGAE
NTVATPLASTHRGLSGDTLAFPTKFTILDVSSNFEIDIEVYCLVQKRDVCSDKKKKPSKS
KAITPKRFLAITQSRSTSTTVVASPGGPNAVRTSNFVLVGSHKLTLSSIGTNKFPLEKVP
FLCPLEGHVYLKMQCEVGSKVEEKGFLTMFEDVSGFGAWHRRWCVLSGYCISYWTYPDDE
KRKNPIGRINLANCTSKKVEPANREFCARPNTFELITVRPQKADDKETLVSQCQNTMCVT
KNWLCADTKDERNLWMKKLNQIVVDLRMWQPDACYRPL
Download sequence
Identical sequences G3NZG9
ENSGACP00000010742 69293.ENSGACP00000010742 ENSGACP00000010742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]